DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and Cd86

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:XP_006521804.1 Gene:Cd86 / 12524 MGIID:101773 Length:314 Species:Mus musculus


Alignment Length:290 Identity:62/290 - (21%)
Similarity:104/290 - (35%) Gaps:96/290 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 IDDYQTIISQA---GTHAYLPC--------NVKQLVKKPISWLRMRDGHILTVDQTTFIADQRFQ 246
            |.|..::.:||   || |||||        ::.:||   :.|   :|...|.:.: .::..::..
Mouse    25 ISDAVSVETQAYFNGT-AYLPCPFTKAQNISLSELV---VFW---QDQQKLVLYE-HYLGTEKLD 81

  Fly   247 SV---------FSPNPERWSLQIKYVQLKDEGTYECQVSTEPKASAIV------HLRIV----EP 292
            ||         |..|  .|:|::..||:||.|:|:|.:..:|...:|:      .|.::    ||
Mouse    82 SVNAKYLGRTSFDRN--NWTLRLHNVQIKDMGSYDCFIQKKPPTGSIILQQTLTELSVIANFSEP 144

  Fly   293 KTELIGESTRHVKAGSQVKLRCIISQALEPP---LFI-----NWFYNQKQIYLHN---------- 339
            :.:|    .::|...|.:.|.|...|....|   .|:     |.:.:..||...|          
Mouse   145 EIKL----AQNVTGNSGINLTCTSKQGHPKPKKMYFLITNSTNEYGDNMQISQDNVTELFSISNS 205

  Fly   340 -------------------RRGWRTEIERIDLPAEVPTTSTTTTTTTTTASTTTT---------- 375
                               ....:...:.::...|.|  |..|.....|||.|..          
Mouse   206 LSLSFPDGVWHMTVVCVLETESMKISSKPLNFTQEFP--SPQTYWKEITASVTVALLLVMLLIIV 268

  Fly   376 --TTSTTPATPSTTATG-STEGATSSETLN 402
              .....|:.||.||:. ..:.....||:|
Mouse   269 CHKKPNQPSRPSNTASKLERDSNADRETIN 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 30/117 (26%)
V-set 204..290 CDD:284989 28/108 (26%)
Cd86XP_006521804.1 IgV_CD86 33..138 CDD:319336 30/114 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.