DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and si:dkey-24p1.7

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:XP_005173465.1 Gene:si:dkey-24p1.7 / 101883966 ZFINID:ZDB-GENE-121214-215 Length:598 Species:Danio rerio


Alignment Length:501 Identity:89/501 - (17%)
Similarity:161/501 - (32%) Gaps:157/501 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 RLILLALLICLPAIRGQAEETSILNSNGTNGRAFQRTQSRREALIPATTQMAQTLDKASAFRPTM 73
            ::|.|..:|.:.......||      |..||.....:.....|:......::.|.....|..|..
Zfish     2 KIISLCTIIFMLVFNVLCEE------NADNGWNISFSPREVTAVKGLCAHISCTFTYPVAENPIQ 60

  Fly    74 AAALDAAAPNRSSNNVAINNISNNGDQRLRL--TAALEANLIMSNRNV--------QEQHSYRIT 128
            :....:.......|.:..||:..|..::..|  ...||.:|..:|.::        ::::::||.
Zfish    61 SVIWQSCVAKDKCNLIFQNNVEKNKLKKNELGHIKMLEPDLSKNNCSIILKDIKENEKEYTFRIK 125

  Fly   129 QD-----NATSAASIAPNGTAFGDAPSIPIGVAPATTTTID---------PATTTPTTTTRRTTR 179
            ..     |.|...||.       |.|::   |.|..:..::         |...||         
Zfish   126 AKQQYTFNPTVKISIK-------DEPTL---VVPPLSEKVEVNLTCSAPFPCPETP--------- 171

  Fly   180 RPVATTTLKPPP----TIDD--------------YQTIISQAGTH-AYLPCNVKQLVKK------ 219
             ||.|..:|...    .:|:              |.|:|..:..| ..:.|:|:...||      
Zfish   172 -PVITWWIKTKEENYIKLDNNKITQVHSEHVYYSYLTLIPTSDQHDGTVGCDVRYGNKKINTNNT 235

  Fly   220 -PISWLR---------MRDGHILTVDQTTFIADQRFQS---------VFSPNPER-------WSL 258
             .:.:::         :.:|..|.:..|       |:|         .|:.|.:.       .:|
Zfish   236 LEVKYVQALQIVGENTLMEGDTLNLTCT-------FRSHPPASNPVWRFNGNTDNLNTQTSAGTL 293

  Fly   259 QIKYVQLKDEGTYECQVSTEPKA-SAIVHLRIVEPKTELIGESTRHVKAGSQVKLRCIIS---QA 319
            .|..|..:..|.|.|:::...|. :|.:.:.|.|  ..::||:  .:|.|..:.|.|...   |:
Zfish   294 MIANVGKEHAGIYVCEMTYMNKTLNASITINITE--VNILGEN--RLKKGDTLNLTCSFKNHPQS 354

  Fly   320 LEPPLFINWFYNQKQIYLHNRRGWRTEIERIDLPAEVPTTSTTTTTTTTTASTTTTTTSTTPATP 384
            ...|:   |.:|.....|.|:                             ||........  .|.
Zfish   355 SSNPV---WSFNGDADKLKNQ-----------------------------ASAANLIIDN--VTK 385

  Fly   385 STTATGSTEGATSSETLNGLVTITRSYILDAISQNDVSELGAAAGV 430
            ......:.|.....:|||..:|:.       |:::|:......|||
Zfish   386 EHAGIYACEMTYMKKTLNASITVD-------ITEHDMGRNNTRAGV 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 22/125 (18%)
V-set 204..290 CDD:284989 20/119 (17%)
si:dkey-24p1.7XP_005173465.1 Ig 27..132 CDD:299845 15/104 (14%)
IG_like 251..325 CDD:214653 15/80 (19%)
Ig 254..323 CDD:299845 15/75 (20%)
ig 336..394 CDD:278476 13/91 (14%)
IG_like 339..408 CDD:214653 16/102 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.