DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and havcr2

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:XP_003200921.2 Gene:havcr2 / 100536120 ZFINID:ZDB-GENE-091204-20 Length:231 Species:Danio rerio


Alignment Length:256 Identity:49/256 - (19%)
Similarity:71/256 - (27%) Gaps:88/256 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 IISQAGTHAYLPCNVKQLVKKP--ISWLRMR-----DGHILTVD--QTTFIADQRFQSVFSPNPE 254
            :|...|....|||........|  :.|.|.:     :..::::|  |..:....||......:..
Zfish    24 VIGLVGDTVTLPCKYDINTNGPLGVCWGRHQSLFSCENTVISIDGLQLNYRESHRFSLDSGLDRG 88

  Fly   255 RWSLQIKYVQLKDEGTYECQVSTEPKASAIVHLRIVEPKTELIGESTRHVKAGSQVKLRCIISQA 319
            ..||.|:.||..|.|.|.|::..                                          
Zfish    89 DVSLTIRAVQKSDAGMYVCRIEI------------------------------------------ 111

  Fly   320 LEPPLFINWFYNQKQIYLHNRRGWRTEIERIDLPAEVPTTSTTTTTTTTTASTTTTTTSTTPATP 384
              |.||.:..||   :||..|.|       :|....|..|....||..........:.|||    
Zfish   112 --PGLFNDISYN---VYLFIRSG-------LDPKRVVSETQLAPTTAKQEKQVHLVSDSTT---- 160

  Fly   385 STTATGSTEGATSSETLNGLVTITRSYILDAISQNDVSELGAAAGVAVATETSTAQLLTEV 445
                                 .||..|::......|...:|....||...||....::|.|
Zfish   161 ---------------------LITELYLISEKMTTDDVRMGEVKAVAHTEETMETFIITTV 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 21/98 (21%)
V-set 204..290 CDD:284989 20/94 (21%)
havcr2XP_003200921.2 V-set 19..109 CDD:284989 21/84 (25%)
IG_like 21..110 CDD:214653 21/85 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.