DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and mov10

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:XP_002932163.1 Gene:mov10 / 100491926 XenbaseID:XB-GENE-483538 Length:972 Species:Xenopus tropicalis


Alignment Length:257 Identity:56/257 - (21%)
Similarity:86/257 - (33%) Gaps:77/257 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AKMPRRLI----LLALLICLP----AIR-GQAEETSIL---NSNGTNGRAFQRTQSRREALIPAT 56
            |||.:..|    .|:..:.||    ||| .||:.....   :|.||..:.|.....||...|.  
 Frog    42 AKMTQDRIQLKKFLSKTVSLPDQYLAIRKDQAQHAKASADGSSTGTQAQRFTEWMKRRTEFIS-- 104

  Fly    57 TQMAQTLDKASAFRPTMAAALDAAAPNRSSNNVAINNISNNGDQRLRLTAALEAN----LIMSNR 117
                   ||                     |.::|::..:..|.|:|....||..    :|:.|:
 Frog   105 -------DK---------------------NGISISSEYDLSDGRIRFHLPLEEEKIFPIIIQNK 141

  Fly   118 NVQEQHSYRITQDNATSAASIAPNGTAFGDAPSIPIGVAPATTTTIDPATTT------PTTTT-- 174
            :   ..|...||........|......:..:.|.||.:||.....|...:.|      |.|..  
 Frog   142 S---SESVIFTQYKVLRKMRIFSFEDEYKVSLSKPIKLAPGDEYEIKVYSCTAHYGYFPITLVFE 203

  Fly   175 -RRTTRRPVATTTLKPPPTIDDYQTIISQA-------GTHAYLPCNVKQLVKKPISWLRMRD 228
             ||.:.        .|...|..:.:.:|.:       .|..|:|  .::..:|||.  |:.|
 Frog   204 FRRDSN--------SPSFHIGRFLSAVSNSKLAERLGPTSKYIP--FQRNFRKPIK--RIED 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 9/39 (23%)
V-set 204..290 CDD:284989 8/25 (32%)
mov10XP_002932163.1 DEXXQc_Helz-like 478..716 CDD:350796
SF1_C_Upf1 717..918 CDD:350195
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.