DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and iglon5

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:XP_002938252.1 Gene:iglon5 / 100488314 XenbaseID:XB-GENE-945713 Length:333 Species:Xenopus tropicalis


Alignment Length:315 Identity:77/315 - (24%)
Similarity:125/315 - (39%) Gaps:58/315 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 VATTTLKPPPTIDDYQTIISQAGTHAYLPCNVKQLVKKPISWLRMRDGHILTVDQTTFIADQRFQ 246
            |..|...||  .|:|  .:|| |.:|.|.|.:...|.: ::||..  .:||...:..:..|.|.|
 Frog    24 VQCTEFVPP--ADNY--TVSQ-GDNATLSCLIDDKVTR-VAWLNR--SNILYAGKDKWSIDSRVQ 80

  Fly   247 SVFSPNPERWSLQIKYVQLKDEGTYECQVSTEPKASAIVHLRIVEPKTELIG-ESTRHVKAGSQV 310
            .:.:...| :|:.|.:|.:.|||.|.|...||.|........||:...:::. .|:..|..||.|
 Frog    81 LLTNTKSE-YSIVITHVDVADEGLYTCSFQTEDKPHTSQVYLIVQVPAKIVNISSSVTVNEGSNV 144

  Fly   311 KLRCIISQALEPPLFINWFYNQKQIYLHNRRGWRTEIERIDLPAEVPTTSTTTTTTTTTASTTTT 375
            .|:|:.....||.  |.|    :|:    ..|:.:|.|.:::          |......|.....
 Frog   145 NLQCLAVGKPEPT--ITW----QQL----SEGFSSEGELLEI----------TEINRQQAGDYEC 189

  Fly   376 TTSTTPATPSTTATGSTEGATSSETLNGLVTITRS---YILDAISQNDVSELGAAAGV---AVAT 434
            .||...:.|.|..                |.||.:   ||.|.  :|..|.:|..|.:   |:|.
 Frog   190 VTSNGVSVPDTKK----------------VQITVNYPPYITDV--KNAQSPVGRPATLRCKAMAV 236

  Fly   435 ETSTAQLLTEVEATSSTSGTSTGAGLLASTSAAYAAGAAAGITTAATGDSAATAA 489
            ..:..:...: |.....|||.   ||...|.::::....:.:|:...|:....|:
 Frog   237 PPAEFEWYKD-EKRRLISGTE---GLSIKTESSWSVIVFSNVTSRHYGNYTCLAS 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 26/91 (29%)
V-set 204..290 CDD:284989 24/85 (28%)
iglon5XP_002938252.1 Ig 31..123 CDD:299845 30/100 (30%)
IG_like 35..123 CDD:214653 27/94 (29%)
Ig 126..207 CDD:299845 23/116 (20%)
I-set 128..207 CDD:254352 23/114 (20%)
I-set 210..299 CDD:254352 19/84 (23%)
Ig 227..298 CDD:143165 13/65 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.