DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and Kirrel2

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:XP_038957463.1 Gene:Kirrel2 / 100359836 RGDID:1308456 Length:711 Species:Rattus norvegicus


Alignment Length:469 Identity:95/469 - (20%)
Similarity:149/469 - (31%) Gaps:142/469 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 PPTIDDYQTIISQAGTHAYLPCNV---KQLVKKPISWLRMRDGHILTVDQTTFIADQRFQSVFSP 251
            |..:...:.::...|..|.|||.:   :.||:    |  .:||..|                   
  Rat    32 PHFLQQPEDMVVLLGQEARLPCALGAYRGLVQ----W--TKDGLAL------------------- 71

  Fly   252 NPER----WS--------------LQIKYVQLKDEGTYECQVSTEPKAS--AIVHLRIVEPKTEL 296
            ..||    ||              |.||.|:|:||.:||||.|.....|  |.:|:.:.....::
  Rat    72 GGERDLPGWSRYWISGNSASGQHDLHIKPVELEDEASYECQASQAGLRSRPAQLHVMVPPEAPQV 136

  Fly   297 IGESTRHVKAGSQVKLRCIISQALEPPLFINWFYNQKQIYLHNRRGWRTEIERIDLPAEVPTTST 361
            :|..:..:.||....|.|.......|...:.||          |.|.|.:             .|
  Rat   137 LGGPSVSLVAGVPGNLTCRSRGDARPAPELLWF----------RDGIRLD-------------GT 178

  Fly   362 TTTTTTTTASTTTTTTSTTPATPSTTATGSTEGATSSETLNGLVTITRSYILDAISQNDVS-ELG 425
            :....|.....|.|..:|...|||:...|:|           |:...||..|.......|: .|.
  Rat   179 SFHQITLRDKATGTVENTLFLTPSSQDDGAT-----------LICRARSQALPTGRDTAVTLSLQ 232

  Fly   426 AAAGVAVATETSTAQ------LLTEVEATSSTSG---TSTGAGLLASTSAAYAAGAAAGITTAAT 481
            ....|.::.|..|||      .|.:..|....:|   ...|:.:|.:........|.|...|...
  Rat   233 YPPMVTLSAEPQTAQEGEKVTFLCQATAQPPVTGYRWAKGGSPVLGARGPRLEVVADATFLTEPV 297

  Fly   482 GDSAATAATTSAWLTTMD------------------AEAATTAATTTTTMLPSSSFIK----QIT 524
            ....:.|..::...|.::                  .:.|:.:.......||..|:.:    |:.
  Rat   298 SCEVSNAVGSANRSTALEVLYGPILQAKPKPVSVDVGKDASFSCVWRGNPLPRISWTRLGGSQVL 362

  Fly   525 TA--SLIIPAVVKLDSGNYTCSPS-----------------NSAPRTIVLH----VLNGEYSASA 566
            ::  :|.:|:|...|:|:|.|...                 |:.|....||    .|.|......
  Rat   363 SSGPTLRLPSVALEDAGDYVCRAEPRRTGVGGGTAQARLTVNAPPVVTALHPAPAFLRGPARLQC 427

  Fly   567 I-----KSGSVSWS 575
            :     ...||.||
  Rat   428 VVFASPAPDSVVWS 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 30/114 (26%)
V-set 204..290 CDD:284989 30/108 (28%)
Kirrel2XP_038957463.1 IG_like 38..127 CDD:214653 29/113 (26%)
Ig strand A' 40..44 CDD:409353 0/3 (0%)
Ig strand B 48..57 CDD:409353 4/8 (50%)
Ig strand C 62..66 CDD:409353 2/9 (22%)
Ig strand D 75..85 CDD:409353 3/9 (33%)
Ig strand E 88..100 CDD:409353 2/11 (18%)
Ig strand F 107..115 CDD:409353 4/7 (57%)
Ig strand G 117..127 CDD:409353 2/9 (22%)
Ig 133..231 CDD:416386 26/131 (20%)
Ig strand A 134..137 CDD:409353 0/2 (0%)
Ig strand A' 140..144 CDD:409353 0/3 (0%)
Ig strand B 151..158 CDD:409353 2/6 (33%)
Ig strand C 164..169 CDD:409353 0/4 (0%)
Ig strand C' 172..174 CDD:409353 1/1 (100%)
Ig strand D 177..184 CDD:409353 1/6 (17%)
Ig strand E 191..199 CDD:409353 2/7 (29%)
Ig strand F 208..216 CDD:409353 2/18 (11%)
Ig strand G 222..228 CDD:409353 0/5 (0%)
Ig_3 234..303 CDD:404760 13/68 (19%)
Ig strand B 252..256 CDD:409353 0/3 (0%)
Ig strand C 266..270 CDD:409353 1/3 (33%)
Ig strand E 283..286 CDD:409353 0/2 (0%)
Ig strand F 292..301 CDD:409353 1/8 (13%)
Ig strand G 309..312 CDD:409353 0/2 (0%)
Ig 326..403 CDD:416386 12/76 (16%)
Ig strand A' 327..332 CDD:409353 0/4 (0%)
Ig strand B 335..344 CDD:409353 1/8 (13%)
Ig strand C 350..354 CDD:409353 1/3 (33%)
Ig strand C' 357..359 CDD:409353 0/1 (0%)
Ig strand D 362..365 CDD:409353 0/2 (0%)
Ig strand E 366..371 CDD:409353 1/4 (25%)
Ig strand F 379..387 CDD:409353 3/7 (43%)
Ig strand G 393..403 CDD:409353 0/9 (0%)
Ig 405..509 CDD:416386 9/37 (24%)
Ig strand A 406..410 CDD:409353 1/3 (33%)
Ig strand A' 412..415 CDD:409353 2/2 (100%)
Ig strand B 423..430 CDD:409353 0/6 (0%)
Ig strand C 437..442 CDD:409353 4/5 (80%)
Ig strand C' 444..447 CDD:409353
Ig strand D 455..462 CDD:409353
Ig strand E 472..479 CDD:409353
Ig strand F 490..497 CDD:409353
Ig strand G 500..507 CDD:409353
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.