DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and LOC100333752

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:XP_002667350.3 Gene:LOC100333752 / 100333752 -ID:- Length:634 Species:Danio rerio


Alignment Length:237 Identity:44/237 - (18%)
Similarity:88/237 - (37%) Gaps:43/237 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 IISQAGTHAYLPCNVKQLVKKP---ISWLRMRDGHI--LTVD--------------QTTFIADQR 244
            :::..|:...|||...:|:...   :.|.|....::  |.:|              :..||.::.
Zfish    28 LVAPLGSSVVLPCFASELLPAEGLRVEWRRTDSNNLVHLIIDGKSRAEEQHQDYYQRAHFITEEI 92

  Fly   245 FQSVFSPNPERWSLQIKYVQLKDEGTYECQVSTEPKASA-IVHLRIVEPKTELIGESTRHVKAGS 308
            ...|:       ||::..::..|:|.|.|:|.::..|.| :|.::.||..:.........|..|.
Zfish    93 QHGVY-------SLRLDDLRADDKGLYRCKVYSQRDAGATLVEIKAVEYLSVSGSAGPVSVSVGG 150

  Fly   309 QVKLRCIISQALEPPLF--INW---------FYNQKQIYLHNRRGWRTEIERIDLPAEVPTTSTT 362
            .|.|.|.:...:.|...  ::|         .:.:|...:.....:|..:  :..|:|:|..:.:
Zfish   151 HVTLSCSVKSHVPPEEIERVSWRKADEDLQLLHFEKSAVIPADERYRERV--VFFPSEIPKGNFS 213

  Fly   363 T---TTTTTTASTTTTTTSTTPATPSTTATGSTEGATSSETL 401
            .   :..|..|........|...:.:||....|...:...||
Zfish   214 VRLRSVRTEDAGVYMCLVKTGGVSANTTVIIETHSLSEFHTL 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 22/109 (20%)
V-set 204..290 CDD:284989 22/105 (21%)
LOC100333752XP_002667350.3 IG_like 25..126 CDD:214653 21/104 (20%)
Ig 33..130 CDD:299845 22/103 (21%)
IG_like 142..244 CDD:214653 17/103 (17%)
V-set 142..233 CDD:284989 14/92 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.