DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and myot

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:XP_002664374.4 Gene:myot / 100329862 ZFINID:ZDB-GENE-110411-129 Length:814 Species:Danio rerio


Alignment Length:398 Identity:79/398 - (19%)
Similarity:136/398 - (34%) Gaps:106/398 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 TNGRAFQRTQSRREALIPATTQMAQTLD----KASAFRPTMAAALDAAAPNRSSNNVAINNISNN 97
            |..|:.|.:.      :|..|..:..|.    |.:..||...|..:..   :.|.:..:.::   
Zfish   442 TTARSLQSSP------VPHITYTSNMLPKPILKKNVSRPVSRATDEDI---QGSKDALMQDL--- 494

  Fly    98 GDQRLRLTAALEANLIMSNRNVQEQHSY--RITQD--NATSAASIAPNGTAFGDAPSIPIGVAPA 158
             :|:||       |.:...||.|::.||  |:.:.  .|.:|||:.....:|...|:.| |    
Zfish   495 -EQKLR-------NKVPQQRNNQQKISYEERMARRLLGADNAASVFHLENSFSSQPAQP-G---- 546

  Fly   159 TTTTIDPATTTP---TTTTRRTTRRPVATTTLK----PPPTIDDYQTIISQAGTHAYLPCNVKQL 216
                 .|....|   .:..:|:.......:|::    .|..|...|.:..:.|....:...|..|
Zfish   547 -----SPEDQYPGGIWSRKKRSGGDSTEASTIQEKCFAPRFIQVPQDVTVEEGRFCRIDFKVVGL 606

  Fly   217 VKKPISW------LRMRDGHILTVDQTTFIADQRFQSVFSPNPERWSLQIKYVQLKDEGTYECQV 275
            ....|||      :|..|.|.:.|.:         :||.       |..|:.|.:...|.|||..
Zfish   607 PTPDISWYLDGKPIRPDDYHKMLVCE---------KSVH-------SFIIEIVTIHHAGLYECIA 655

  Fly   276 STEPKASAI-VHLRIVE-----PKTELIGESTRHVKAGSQVKLRCIISQALEPPLFINWFYNQKQ 334
            ......|.. :||.::.     |.|.::.....|...|..|:|.|.::.:..|.|:  |..:::.
Zfish   656 KNRAGQSQFSLHLDVIAQEQLCPPTFVVKMKNSHAMEGDAVRLECKVNASPSPQLY--WKKDKEM 718

  Fly   335 IYLHNRR-----------------------GWRTEIERIDLPAEVPTTSTTTTTTTTTASTTTTT 376
            :.:.:.|                       ||.|       .:.:.....:|.......:|....
Zfish   719 LRIDHTRMSLSQDSSGKQCLVINPVMKSDAGWYT-------VSAINEAGMSTCNARLDVATRLNK 776

  Fly   377 TSTTPATP 384
            | |.||.|
Zfish   777 T-THPARP 783

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 23/98 (23%)
V-set 204..290 CDD:284989 22/92 (24%)
myotXP_002664374.4 I-set 68..165 CDD:254352
Ig 85..161 CDD:143165
Ig 579..665 CDD:299845 23/101 (23%)
I-set 580..670 CDD:254352 25/105 (24%)
I-set 679..770 CDD:254352 14/99 (14%)
Ig 696..770 CDD:299845 11/82 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.