DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and timd4

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_001116089.1 Gene:timd4 / 100142639 ZFINID:ZDB-GENE-080303-10 Length:259 Species:Danio rerio


Alignment Length:125 Identity:26/125 - (20%)
Similarity:42/125 - (33%) Gaps:40/125 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 LQIKYVQLKDEGTYECQVSTE----------------------PKASAIVHLRIVEPKTELIGES 300
            |.|:.:|..|.|.|.|:|..|                      ||.:..:....:|.:|..:.:.
Zfish    96 LGIQKIQKSDSGPYCCRVDIEGFFNDKKMSYTLQVMKAPTTVAPKTTTQITTEPMETQTASLSDP 160

  Fly   301 TRHVKAGSQVKLRCIISQALEPPLFINWFYNQKQIYLHNRRGWRTEIERIDLPAEVPTTS 360
            :|    |....|.           .|:|   |.:.::|:.......|.||.|...:|..|
Zfish   161 SR----GGDSSLN-----------DISW---QNETHVHSGAMMEELISRIMLQINIPVLS 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 11/52 (21%)
V-set 204..290 CDD:284989 11/53 (21%)
timd4NP_001116089.1 IG_like 29..130 CDD:214653 9/33 (27%)
Ig 29..113 CDD:299845 7/16 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.