DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and negr1

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:XP_031755650.1 Gene:negr1 / 100127726 XenbaseID:XB-GENE-987949 Length:388 Species:Xenopus tropicalis


Alignment Length:352 Identity:86/352 - (24%)
Similarity:134/352 - (38%) Gaps:54/352 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 PTIDDYQTIISQAGTHAYLPCNVKQLVKKPISWLRMRDGHILTVDQTTFIADQRFQSVFSPNPER 255
            |.:|:   ::.:.|..|.|.|.:::...|. :||..  ..|:......:..|.|. |:.:.:.:.
 Frog    44 PAVDN---LVVRQGETAMLRCFLEEGASKG-AWLNR--SSIIFAGGDKWSVDPRV-SIATSSKQE 101

  Fly   256 WSLQIKYVQLKDEGTYECQVSTEPKASAI-VHLRI-VEPKTELIGESTRHVKAGSQVKLRCIISQ 318
            :||:|:.|.:.|:|.|.|.|.||.....: |||.: |.||...| .|...|..|:.|.|.|:.:.
 Frog   102 YSLRIQKVDVSDDGPYTCSVQTEHSPRTLQVHLTVHVSPKIYDI-SSDMTVNEGTNVSLICLATG 165

  Fly   319 ALEPPLFINWFY---NQKQI----YLHNRRGWRTEIERIDLPAEVPTTSTTTTTTTTTASTTTTT 376
            ..||.  |:|.:   :.||.    ||......|.:....:..||...:.........|.:...|.
 Frog   166 KPEPS--ISWRHISPSAKQFGSGQYLDIYGITRDQAGDYECSAENDVSFPDVKKVKVTVNFAPTI 228

  Fly   377 TSTTPATPSTTATGSTEGATSS-------------ETLNGLVTI------TRSYILDAISQNDVS 422
            ...||...|...||.....|::             :..||...|      |||.:  .:|.....
 Frog   229 LEITPTGVSLGRTGLIRCETAAVPAPVFEWYKGEKKLTNGQRGIRIQNYNTRSIL--TVSNVTEE 291

  Fly   423 ELGAAAGVAV-ATETSTAQL-LTEVEATSSTSGTSTGA-------GLLASTSAAYAAGAAAGITT 478
            ..|....||| ...||.|.| |.::...|:||..::.|       ...:|....|||.     :|
 Frog   292 HFGNYTCVAVNKLGTSNASLPLNQIIEPSTTSPVTSSAKYSVKHYARSSSDKPHYAAP-----ST 351

  Fly   479 AATGDSAATAATTSAWLTTMDAEAATT 505
            |..|.:.......|.|...:...:.|:
 Frog   352 AQYGITGRAEILFSCWYLVLTLSSFTS 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 25/92 (27%)
V-set 204..290 CDD:284989 25/87 (29%)
negr1XP_031755650.1 Ig 44..136 CDD:416386 27/98 (28%)
FR1 44..62 CDD:409353 5/20 (25%)
Ig strand A' 47..53 CDD:409353 1/8 (13%)
Ig strand B 55..63 CDD:409353 3/7 (43%)
CDR1 63..68 CDD:409353 0/4 (0%)
FR2 69..75 CDD:409353 3/6 (50%)
Ig strand C 69..74 CDD:409353 2/5 (40%)
CDR2 76..87 CDD:409353 1/10 (10%)
Ig strand C' 78..82 CDD:409353 1/3 (33%)
Ig strand C' 84..87 CDD:409353 0/2 (0%)
FR3 88..122 CDD:409353 11/34 (32%)
Ig strand D 91..98 CDD:409353 2/7 (29%)
Ig strand E 101..107 CDD:409353 2/5 (40%)
Ig strand F 114..122 CDD:409353 3/7 (43%)
CDR3 123..127 CDD:409353 2/3 (67%)
Ig strand G 127..136 CDD:409353 3/8 (38%)
FR4 129..136 CDD:409353 3/6 (50%)
Ig_3 140..208 CDD:404760 19/70 (27%)
Ig strand A' 146..151 CDD:409353 1/4 (25%)
Ig strand B 157..164 CDD:409353 3/6 (50%)
Ig strand C 170..175 CDD:409353 2/6 (33%)
Ig strand C' 177..179 CDD:409353 0/1 (0%)
Ig strand E 187..193 CDD:409353 2/5 (40%)
Ig strand F 200..207 CDD:409353 0/6 (0%)
Ig strand G 214..222 CDD:409353 0/7 (0%)
Ig_3 226..302 CDD:404760 17/77 (22%)
putative Ig strand A 226..232 CDD:409353 1/5 (20%)
Ig strand B 242..246 CDD:409353 1/3 (33%)
Ig strand C 255..259 CDD:409353 0/3 (0%)
Ig strand E 281..285 CDD:409353 1/5 (20%)
Ig strand F 295..300 CDD:409353 0/4 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.