DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and lsamp

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:XP_031751462.1 Gene:lsamp / 100124984 XenbaseID:XB-GENE-5759171 Length:368 Species:Xenopus tropicalis


Alignment Length:342 Identity:78/342 - (22%)
Similarity:119/342 - (34%) Gaps:71/342 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 IISQAGTHAYLPCNVKQLVKKPISWLRMRDGHILTVDQTTFIADQRFQSVFSPNPE-------RW 256
            |..:.|..|.|.|.|:....: ::||. |.|.|       |..|.::.  ..|..|       .:
 Frog    41 ITVRQGDTAILRCFVEDRSSR-VAWLN-RSGII-------FAGDDKWS--LDPRVELEKRSLLEY 94

  Fly   257 SLQIKYVQLKDEGTYECQVSTE--PKASAIVHLRIVEPKTELIGESTRHVKAGSQVKLRCIISQA 319
            ||:|:.|.:.|||.|.|.|.|:  .|.:.:..:..|.||...|..... |..||.|.|.||....
 Frog    95 SLRIQKVDVSDEGPYTCSVQTKQHTKTTQVYLIVQVPPKISNISADIT-VNEGSNVTLMCIAYGR 158

  Fly   320 LEPPLFINW--------------FYNQKQIYLHNRRGWRTEIERIDLPA--EVPTTSTTTTTTTT 368
            .||  .|.|              |..::: :|..:...|.:..|.:..|  ||.:........|.
 Frog   159 PEP--MITWRHLTPTAGTSPARDFEGEEE-FLEIQGITREQSGRYECKAANEVASADVKQVRVTV 220

  Fly   369 TASTTTTTTSTTPATPSTTATGSTEGA-------------TSSETLN---GLV---TITRSYILD 414
            ......|.:.:..||....|....|.:             |.|..:|   ||.   |.:||.::.
 Frog   221 NYPPIITESKSNEATTGKQAILRCEASAVPAPDFEWYKDDTRSRRINSAQGLEIRNTGSRSVLMV 285

  Fly   415 A-ISQNDVSELGAAAGVAVATETSTAQLLTEVEATSSTSGTSTGAGLLASTSAAYAAGAAAGITT 478
            | :::.........|...:....::..|...|..|...|.:..|    ::....|..|....|  
 Frog   286 ANVTEEHYGNYTCVAANKLGITNTSLYLYKRVSPTKPMSASERG----SNVHYQYKVGPGTPI-- 344

  Fly   479 AATGDSAATAATTSAWL 495
                 .:||:...|.||
 Frog   345 -----DSATSLAASLWL 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 27/98 (28%)
V-set 204..290 CDD:284989 26/94 (28%)
lsampXP_031751462.1 Ig 38..128 CDD:416386 27/97 (28%)
FR1 38..54 CDD:409353 4/12 (33%)
Ig strand A' 39..45 CDD:409353 1/3 (33%)
Ig strand B 47..55 CDD:409353 3/7 (43%)
CDR1 55..59 CDD:409353 1/3 (33%)
FR2 60..67 CDD:409353 2/8 (25%)
Ig strand C 60..66 CDD:409353 1/6 (17%)
CDR2 68..78 CDD:409353 4/16 (25%)
Ig strand C' 70..73 CDD:409353 1/9 (11%)
Ig strand C' 75..78 CDD:409353 1/2 (50%)
FR3 79..114 CDD:409353 11/36 (31%)
Ig strand D 83..90 CDD:409353 1/6 (17%)
Ig strand E 93..99 CDD:409353 2/5 (40%)
Ig strand F 106..114 CDD:409353 4/7 (57%)
CDR3 115..119 CDD:409353 1/3 (33%)
Ig strand G 119..128 CDD:409353 1/8 (13%)
FR4 121..128 CDD:409353 0/6 (0%)
Ig_3 131..206 CDD:404760 19/78 (24%)
Ig strand A' 138..143 CDD:409353 0/5 (0%)
Ig strand B 149..156 CDD:409353 4/6 (67%)
Ig strand C 162..167 CDD:409353 2/4 (50%)
Ig strand C' 173..175 CDD:409353 0/1 (0%)
Ig strand E 185..191 CDD:409353 1/6 (17%)
Ig strand F 198..205 CDD:409353 1/6 (17%)
Ig strand G 212..220 CDD:409353 0/7 (0%)
Ig_3 223..302 CDD:404760 15/78 (19%)
putative Ig strand A 224..230 CDD:409353 1/5 (20%)
Ig strand B 240..244 CDD:409353 1/3 (33%)
Ig strand C 253..257 CDD:409353 0/3 (0%)
Ig strand E 281..285 CDD:409353 1/3 (33%)
Ig strand F 295..300 CDD:409353 0/4 (0%)
Ig strand G 308..311 CDD:409353 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.