DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr17 and OBSCN

DIOPT Version :10

Sequence 1:NP_731670.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_001373054.1 Gene:OBSCN / 84033 HGNCID:15719 Length:8925 Species:Homo sapiens


Alignment Length:616 Identity:125/616 - (20%)
Similarity:217/616 - (35%) Gaps:141/616 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 TTEMTVAGRAERAGVGAPWCRRFFHTSPLASWLRISFVLLVLPALGFGIQVVTCS--NPELGAS- 126
            |....||....|...|...||  .....:...||:|     .|...|..:...|.  ..|:||| 
Human   851 TRHRLVAATVTRQDEGTYSCR--VGEDSVDFRLRVS-----EPKAVFAKEQPACREVQAEVGASA 908

  Fly   127 ------APDPVDLTWGGKNTEGQLTTATRSTLPDSPMTTQNDLITTASNLATAKKPATAASEAV- 184
                  |.|.:::||   ..:|:..:::.....::....:..::.......:.:....|..:.| 
Human   909 TLSCEVAQDQMEVTW---YKDGKKLSSSSKVHVEAVGCMRRLVVQQVGQADSGEYSCEARGQRVS 970

  Fly   185 --VDTAETAETAPPTEATSSWSSTAVARGMSSADGAGEAIATSQSAQIGLTTQATVRQTEAQTAS 247
              :|.||....         ::...:||....|:....|..:.:.||  ..|:.|..:...:.:|
Human   971 FRLDVAEPKVV---------FAKEQLARRKLQAEAGASATLSCEVAQ--AQTEVTWYKDGKKLSS 1024

  Fly   248 TATQAAAATSAATSAAI--ASAAAATETAAEMLISTIYPASTETDLHNSIERVEGQRGKMANAFH 310
            ::.....||.......:  |..|.|.|.:.|                     ..|||    .:||
Human  1025 SSKVCMEATGCTRRLVVQQAGQADAGEYSCE---------------------AGGQR----LSFH 1064

  Fly   311 PGVPDSLTKGFSIPTFLPPFPVFAAADLPAYRAAADAAEAAKLAAEAA-AQAAA-----AKTSSE 369
            ..|.:             |..|||...:......|:|..:|.|:.|.| ||...     .|..|.
Human  1065 LDVKE-------------PKVVFAKDQVAHSEVQAEAGASATLSCEVAQAQTEVMWYKDGKKLSS 1116

  Fly   370 AVTMSPEEQ--RRQMFNEQHSYLAAHRDGGD------GAGSAVRRNLTMPVL----------NIT 416
            ::.:..|.:  ||::..:|    |...|.||      |...:.|.::|.|.:          .:.
Human  1117 SLKVHVEAKGCRRRLVVQQ----AGKTDAGDYSCEARGQRVSFRLHITEPKMMFAKEQSVHNEVQ 1177

  Fly   417 AQMGNHAYMPCQIHRLSDKPVSWVRMRDNHIISVDETTFIADERFQSIYQEDHDYTWSLQIKYVE 481
            |:.|..|.:.|::.: :...|:|  .:|...:|..          ..:..|....|..|.:....
Human  1178 AEAGASAMLSCEVAQ-AQTEVTW--YKDGKKLSSS----------SKVGMEVKGCTRRLVLPQAG 1229

  Fly   482 PSDAGWYECQMATEPKLSAKVHLQIVKPKTELIGDQSRF----VKAGSKVALHCIVRGTLDPPKY 542
            .:|||.|.|:...:   ....||.|.:||.....:||..    .:||:...|.|.|   ..|...
Human  1230 KADAGEYSCEAGGQ---RVSFHLHITEPKGVFAKEQSVHNEVQAEAGTTAMLSCEV---AQPQTE 1288

  Fly   543 IIWFRGQKKISDSDERTGWYTQLDRNIFGTVGDNQNTIGSLIIPLVRKEDSGNYTCQPSNSVSVS 607
            :.|::..||:|.|       :::...:.|..       ..|::..|.|.|:|.|:|: :....||
Human  1289 VTWYKDGKKLSSS-------SKVRMEVKGCT-------RRLVVQQVGKADAGEYSCE-AGGQRVS 1338

  Fly   608 VDLHVLSGE--YSASAIMSTAARTTKGGRST 636
            ..||:...:  ::...::....||..|..:|
Human  1339 FQLHITEPKAVFAKEQLVHNEVRTEAGASAT 1369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr17NP_731670.1 V-set 415..507 CDD:462230 18/91 (20%)
IG_like 521..612 CDD:214653 22/90 (24%)
Ig strand B 527..531 CDD:409353 1/3 (33%)
Ig strand C 542..546 CDD:409353 0/3 (0%)
Ig strand E 581..585 CDD:409353 1/3 (33%)
Ig strand F 595..600 CDD:409353 2/4 (50%)
OBSCNNP_001373054.1 Ig strand F 5004..5009 CDD:409559
Ig strand G 5013..5016 CDD:409559
Ig 5026..5111 CDD:472250
Ig strand B 5042..5046 CDD:409559
Ig strand C 5056..5060 CDD:409559
Ig strand E 5081..5085 CDD:409559
Ig strand F 5095..5100 CDD:409559
Ig strand G 5104..5107 CDD:409559
IG_like 5126..5202 CDD:214653
Ig strand B 5133..5137 CDD:409405
Ig strand C 5146..5150 CDD:409405
Ig strand E 5172..5176 CDD:409405
Ig strand F 5186..5191 CDD:409405
Ig 5205..5293 CDD:472250
Ig strand B 5224..5228 CDD:409405
Ig strand C 5237..5241 CDD:409405
Ig strand E 5263..5267 CDD:409405
Ig strand G 5286..5289 CDD:409405
FN3 5480..5565 CDD:238020
IG_like 5587..>5652 CDD:214653
Ig strand B 5598..5602 CDD:409559
Ig strand C 5610..5614 CDD:409559
Ig strand E 5635..5639 CDD:409559
I-set 5855..5945 CDD:400151
Ig strand B 5872..5876 CDD:409565
Ig strand C 5885..5889 CDD:409565
Ig strand E 5911..5915 CDD:409565
Ig strand F 5925..5930 CDD:409565
Ig strand G 5938..5941 CDD:409565
I-set 6083..6173 CDD:400151
Ig strand B 6100..6104 CDD:409405
Ig strand C 6113..6117 CDD:409405
Ig strand E 6139..6143 CDD:409405
Ig strand F 6153..6158 CDD:409405
Ig strand G 6166..6169 CDD:409405
I-set 6217..6307 CDD:400151
Ig strand B 6234..6239 CDD:409564
Ig strand C 6248..6252 CDD:409564
Ig strand E 6273..6277 CDD:409564
Ig strand F 6287..6292 CDD:409564
Ig strand G 6300..6303 CDD:409564
Ig 6328..6423 CDD:472250
Ig strand B 6345..6349 CDD:409543
Ig strand C 6358..6362 CDD:409543
Ig strand E 6389..6393 CDD:409543
Ig strand F 6403..6408 CDD:409543
Ig strand G 6416..6419 CDD:409543
SH3_Obscurin_like 6559..6621 CDD:212958
RhoGEF 6654..6832 CDD:214619
PH_Obscurin 6839..6963 CDD:270059
IgI_1_Titin-A168_like 6971..7061 CDD:409563
Ig strand A' 6976..6982 CDD:409563
Ig strand B 6987..6995 CDD:409563
Ig strand C 7001..7006 CDD:409563
Ig strand C' 7009..7011 CDD:409563
Ig strand D 7017..7024 CDD:409563
Ig strand E 7027..7033 CDD:409563
Ig strand F 7040..7048 CDD:409563
Ig strand G 7051..7061 CDD:409563
I-set 7065..7154 CDD:400151
Ig strand B 7082..7086 CDD:409564
Ig strand C 7095..7099 CDD:409564
Ig strand E 7122..7126 CDD:409564
Ig strand F 7136..7141 CDD:409564
Ig strand G 7149..7152 CDD:409564
I-set 7314..7403 CDD:400151
Ig strand B 7331..7335 CDD:409565
Ig strand C 7344..7348 CDD:409565
Ig strand E 7370..7373 CDD:409565
Ig strand F 7383..7388 CDD:409565
Ig strand G 7396..7399 CDD:409565
STKc_obscurin_rpt1 7422..7678 CDD:271009
Atrophin-1 7758..>8033 CDD:460830
I-set 8420..8505 CDD:400151
Ig strand B 8437..8441 CDD:409570
Ig strand C 8450..8454 CDD:409570
Ig strand E 8475..8480 CDD:409570
Ig strand F 8490..8495 CDD:409570
Ig strand G 8503..8506 CDD:409570
FN3 8514..8592 CDD:214495
STKc_obscurin_rpt2 8625..8881 CDD:271012
I-set 10..99 CDD:400151
Ig strand B 27..31 CDD:409490
Ig strand C 40..44 CDD:409490
Ig strand E 62..66 CDD:409490
Ig strand F 79..84 CDD:409490
I-set 110..201 CDD:400151
Ig strand B 127..131 CDD:409562
Ig strand C 140..144 CDD:409562
Ig strand E 167..171 CDD:409562
Ig strand F 181..186 CDD:409562
I-set 248..328 CDD:400151
Ig strand B 255..259 CDD:409405
Ig strand C 268..272 CDD:409405
Ig strand E 294..298 CDD:409405
Ig strand F 308..313 CDD:409405
Ig strand G 321..324 CDD:409405
Ig 335..418 CDD:472250
Ig strand B 350..354 CDD:409543
Ig strand C 362..366 CDD:409543
Ig strand E 387..391 CDD:409543
Ig strand F 401..405 CDD:409543
Ig 427..505 CDD:472250
Ig strand B 438..442 CDD:409559
Ig strand C 450..454 CDD:409559
Ig strand E 475..479 CDD:409559
Ig strand F 489..494 CDD:409559
Ig strand G 498..501 CDD:409559
FN3 515..602 CDD:238020
Ig 617..>673 CDD:472250
Ig 711..791 CDD:472250
Ig strand B 724..728 CDD:409559
Ig strand C 736..740 CDD:409559
Ig strand E 761..765 CDD:409559
Ig strand F 775..780 CDD:409559
Ig strand G 784..787 CDD:409559
Ig 807..883 CDD:472250 8/33 (24%)
Ig strand B 815..819 CDD:409559
Ig strand C 827..831 CDD:409559
Ig strand E 853..857 CDD:409559 0/3 (0%)
Ig strand F 867..872 CDD:409559 2/6 (33%)
Ig strand G 876..879 CDD:409559 0/2 (0%)
Ig 894..975 CDD:472250 12/83 (14%)
Ig strand B 908..912 CDD:409559 0/3 (0%)
Ig strand C 920..924 CDD:409559 2/6 (33%)
Ig strand E 945..949 CDD:409559 0/3 (0%)
Ig strand F 959..964 CDD:409559 0/4 (0%)
Ig strand G 968..971 CDD:409559 1/2 (50%)
Ig 986..1067 CDD:472250 21/107 (20%)
Ig strand B 1000..1004 CDD:409559 1/3 (33%)
Ig strand C 1012..1016 CDD:409559 1/3 (33%)
Ig strand E 1037..1041 CDD:409559 0/3 (0%)
Ig strand F 1051..1056 CDD:409559 2/25 (8%)
Ig strand G 1060..1063 CDD:409559 1/6 (17%)
Ig 1078..1159 CDD:472250 20/84 (24%)
Ig strand B 1092..1096 CDD:409559 2/3 (67%)
Ig strand C 1104..1108 CDD:409559 0/3 (0%)
Ig strand E 1129..1133 CDD:409559 1/3 (33%)
Ig strand F 1143..1148 CDD:409559 1/4 (25%)
Ig strand G 1152..1155 CDD:409559 0/2 (0%)
Ig 1170..1251 CDD:472250 18/96 (19%)
Ig strand B 1184..1188 CDD:409559 1/3 (33%)
Ig strand C 1196..1200 CDD:409559 2/5 (40%)
Ig strand E 1221..1225 CDD:409559 1/3 (33%)
Ig strand F 1235..1240 CDD:409559 2/4 (50%)
Ig strand G 1244..1247 CDD:409559 0/2 (0%)
Ig 1262..1343 CDD:472250 24/98 (24%)
Ig strand B 1276..1280 CDD:409559 1/3 (33%)
Ig strand C 1288..1292 CDD:409559 0/3 (0%)
Ig strand E 1313..1317 CDD:409559 1/3 (33%)
Ig strand F 1327..1332 CDD:409559 2/5 (40%)
Ig strand G 1336..1339 CDD:409559 1/2 (50%)
Ig 1359..1435 CDD:472250 4/11 (36%)
Ig strand B 1368..1372 CDD:409559 1/2 (50%)
Ig strand C 1380..1384 CDD:409559
Ig strand E 1405..1409 CDD:409559
Ig strand F 1419..1424 CDD:409559
Ig strand G 1428..1431 CDD:409559
Ig 1446..1527 CDD:472250
Ig strand B 1460..1464 CDD:409559
Ig strand C 1472..1476 CDD:409559
Ig strand E 1497..1501 CDD:409559
Ig strand F 1511..1516 CDD:409559
Ig strand G 1520..1523 CDD:409559
Ig 1538..1619 CDD:472250
Ig strand B 1552..1556 CDD:409559
Ig strand C 1564..1568 CDD:409559
Ig strand E 1589..1593 CDD:409559
Ig strand F 1603..1608 CDD:409559
Ig strand G 1612..1615 CDD:409559
Ig 1630..1711 CDD:472250
Ig strand B 1644..1648 CDD:409559
Ig strand C 1656..1660 CDD:409559
Ig strand E 1681..1685 CDD:409559
Ig strand F 1695..1700 CDD:409559
Ig strand G 1704..1707 CDD:409559
IgI_C2_MyBP-C-like 1722..1803 CDD:409559
Ig strand A 1722..1724 CDD:409559
Ig strand A' 1727..1731 CDD:409559
Ig strand B 1735..1741 CDD:409559
Ig strand C 1748..1753 CDD:409559
Ig strand C' 1756..1759 CDD:409559
Ig strand D 1764..1769 CDD:409559
Ig strand E 1772..1777 CDD:409559
Ig strand F 1786..1792 CDD:409559
Ig strand G 1795..1803 CDD:409559
Ig 1814..1895 CDD:472250
Ig strand B 1828..1832 CDD:409559
Ig strand C 1840..1844 CDD:409559
Ig strand E 1865..1869 CDD:409559
Ig strand F 1879..1884 CDD:409559
Ig strand G 1888..1891 CDD:409559
Ig 1913..1994 CDD:472250
Ig strand B 1927..1931 CDD:409559
Ig strand C 1939..1943 CDD:409559
Ig strand E 1964..1968 CDD:409559
Ig strand F 1978..1983 CDD:409559
Ig strand G 1987..1990 CDD:409559
Ig 2005..2086 CDD:472250
Ig strand B 2019..2023 CDD:409559
Ig strand C 2031..2035 CDD:409559
Ig strand E 2056..2060 CDD:409559
Ig strand F 2070..2075 CDD:409559
Ig strand G 2079..2082 CDD:409559
Ig 2091..2168 CDD:472250
Ig strand B 2111..2115 CDD:409353
Ig strand C 2124..2128 CDD:409353
Ig strand E 2149..2153 CDD:409353
Ig strand F 2163..2168 CDD:409353
Ig 2185..2268 CDD:472250
Ig strand B 2201..2205 CDD:409559
Ig strand C 2213..2217 CDD:409559
Ig strand E 2238..2242 CDD:409559
Ig strand F 2252..2257 CDD:409559
Ig strand G 2261..2264 CDD:409559
Ig 2275..2358 CDD:472250
Ig strand B 2291..2295 CDD:409564
Ig strand C 2304..2307 CDD:409564
Ig strand E 2328..2332 CDD:409564
Ig strand F 2342..2347 CDD:409564
Ig 2365..2444 CDD:472250
Ig strand B 2380..2384 CDD:409543
Ig strand C 2392..2396 CDD:409543
Ig strand E 2417..2421 CDD:409543
Ig strand F 2431..2436 CDD:409543
Ig 2453..2536 CDD:472250
Ig 2542..2625 CDD:472250
Ig strand B 2558..2562 CDD:409559
Ig strand C 2570..2574 CDD:409559
Ig strand E 2595..2599 CDD:409559
Ig strand F 2609..2614 CDD:409559
Ig strand G 2618..2621 CDD:409559
Ig 2631..2714 CDD:472250
Ig strand B 2647..2651 CDD:409353
Ig strand C 2660..2663 CDD:409353
Ig strand E 2684..2688 CDD:409353
Ig strand F 2698..2703 CDD:409353
Ig 2722..2803 CDD:472250
Ig strand B 2736..2740 CDD:409564
Ig strand C 2748..2752 CDD:409564
Ig strand E 2773..2777 CDD:409564
Ig strand F 2787..2792 CDD:409564
Ig strand G 2796..2799 CDD:409564
I-set 2899..2982 CDD:400151
Ig strand B 2915..2919 CDD:409353
Ig strand C 2928..2931 CDD:409353
Ig strand E 2952..2956 CDD:409353
Ig strand F 2966..2971 CDD:409353
Ig 2989..3071 CDD:472250
Ig strand B 3004..3008 CDD:409405
Ig strand C 3016..3020 CDD:409405
Ig strand E 3041..3045 CDD:409405
Ig strand F 3055..3060 CDD:409405
Ig strand G 3064..3067 CDD:409405
Ig 3077..3160 CDD:472250
Ig strand C 3105..3109 CDD:409353
Ig strand E 3130..3134 CDD:409353
Ig strand F 3144..3149 CDD:409353
Ig 3167..3251 CDD:472250
IG_like 3263..3340 CDD:214653
Ig strand B 3273..3277 CDD:409559
Ig strand C 3285..3289 CDD:409559
Ig strand E 3310..3314 CDD:409559
Ig strand F 3324..3329 CDD:409559
Ig strand G 3333..3336 CDD:409559
Ig 3347..3429 CDD:472250
Ig strand B 3362..3366 CDD:409353
Ig strand C 3374..3378 CDD:409353
Ig strand E 3399..3403 CDD:409353
IG_like 3441..3520 CDD:214653
Ig strand B 3451..3455 CDD:409405
Ig strand C 3464..3468 CDD:409405
Ig strand E 3490..3494 CDD:409405
Ig strand G 3513..3516 CDD:409405
Ig 3526..3606 CDD:472250
Ig strand B 3542..3546 CDD:409559
Ig strand C 3554..3558 CDD:409559
Ig strand E 3579..3583 CDD:409559
Ig strand F 3593..3598 CDD:409559
Ig strand G 3602..3605 CDD:409559
Ig 3615..3698 CDD:472250
Ig strand B 3631..3635 CDD:409565
Ig strand C 3644..3647 CDD:409565
Ig strand E 3669..3672 CDD:409565
Ig strand G 3691..3694 CDD:409565
Ig 3704..3786 CDD:472250
Ig strand B 3720..3724 CDD:409559
Ig strand C 3731..3735 CDD:409559
Ig strand E 3756..3760 CDD:409559
Ig strand F 3770..3775 CDD:409559
Ig strand G 3779..3782 CDD:409559
Ig 3792..3874 CDD:472250
Ig strand B 3808..3812 CDD:409559
Ig strand C 3819..3823 CDD:409559
Ig strand E 3844..3848 CDD:409559
Ig strand F 3858..3863 CDD:409559
Ig strand G 3867..3870 CDD:409559
Ig 3880..3962 CDD:472250
Ig strand B 3896..3900 CDD:409559
Ig strand C 3907..3911 CDD:409559
Ig strand E 3932..3936 CDD:409559
Ig strand F 3946..3951 CDD:409559
Ig strand G 3955..3958 CDD:409559
Ig 3968..4050 CDD:472250
Ig strand B 3984..3988 CDD:409544
Ig strand E 4017..4024 CDD:409544
Ig strand F 4034..4039 CDD:409544
Ig strand G 4043..4046 CDD:409544
Ig 4056..4138 CDD:472250
Ig strand B 4072..4076 CDD:409559
Ig strand C 4083..4087 CDD:409559
Ig strand E 4108..4112 CDD:409559
Ig strand F 4122..4127 CDD:409559
Ig strand G 4131..4134 CDD:409559
Ig 4144..4226 CDD:472250
Ig strand B 4160..4164 CDD:409559
Ig strand C 4171..4175 CDD:409559
Ig strand E 4196..4200 CDD:409559
Ig strand F 4210..4215 CDD:409559
Ig strand G 4219..4222 CDD:409559
Ig 4232..4314 CDD:472250
Ig strand B 4248..4252 CDD:409559
Ig strand C 4259..4263 CDD:409559
Ig strand E 4284..4288 CDD:409559
Ig strand F 4298..4303 CDD:409559
Ig strand G 4307..4310 CDD:409559
Ig 4320..4402 CDD:472250
Ig strand B 4336..4340 CDD:409559
Ig strand C 4347..4351 CDD:409559
Ig strand E 4372..4376 CDD:409559
Ig strand F 4386..4391 CDD:409559
Ig strand G 4395..4398 CDD:409559
Ig 4408..4490 CDD:472250
Ig strand B 4424..4428 CDD:409559
Ig strand C 4435..4439 CDD:409559
Ig strand E 4460..4464 CDD:409559
Ig strand F 4474..4479 CDD:409559
Ig strand G 4483..4486 CDD:409559
Ig 4496..4578 CDD:472250
Ig strand B 4512..4516 CDD:409358
Ig strand C 4524..4527 CDD:409358
Ig strand E 4545..4552 CDD:409358
Ig strand F 4562..4567 CDD:409358
Ig 4584..4666 CDD:472250
Ig strand B 4600..4604 CDD:409559
Ig strand C 4611..4615 CDD:409559
Ig strand E 4636..4640 CDD:409559
Ig strand F 4650..4655 CDD:409559
Ig strand G 4659..4662 CDD:409559
IG_like 4679..4754 CDD:214653
Ig strand B 4688..4692 CDD:409559
Ig strand C 4699..4703 CDD:409559
Ig strand E 4724..4728 CDD:409559
Ig strand F 4738..4743 CDD:409559
Ig strand G 4747..4750 CDD:409559
Ig 4760..4842 CDD:472250
Ig strand B 4776..4780 CDD:409559
Ig strand C 4787..4791 CDD:409559
Ig strand E 4812..4816 CDD:409559
Ig strand F 4826..4831 CDD:409559
Ig strand G 4835..4838 CDD:409559
I-set 4847..4931 CDD:400151
Ig strand B 4864..4868 CDD:409559
Ig strand C 4876..4880 CDD:409559
Ig strand E 4901..4905 CDD:409559
Ig strand F 4915..4920 CDD:409559
Ig strand G 4924..4927 CDD:409559
Ig 4937..5007 CDD:472250
Ig strand B 4953..4957 CDD:409559
Ig strand C 4965..4969 CDD:409559
Ig strand E 4990..4994 CDD:409559
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.