DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr17 and Kirrel3

DIOPT Version :9

Sequence 1:NP_001287297.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster
Sequence 2:XP_006510620.1 Gene:Kirrel3 / 67703 MGIID:1914953 Length:803 Species:Mus musculus


Alignment Length:347 Identity:70/347 - (20%)
Similarity:120/347 - (34%) Gaps:53/347 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   276 EMLISTIYPASTETDLHNSIERVEGQRGKMANAFHPGVPDSLTKGFSIPTFLPPFPVFAAADLPA 340
            |.::||::.:..:         ||..:..:..|.:..:|.......:|....||....:....|.
Mouse   206 ESIVSTLFISPGD---------VENGQSIVCRATNKAIPGGKETSVTIDIQHPPLVNLSVEPQPV 261

  Fly   341 YRAAADAAEAAKLAAEAAAQAAAAKTSSEAVTMSPEEQRRQM----FNEQHSYLAAHRDGGDGAG 401
            ..........:..|..|..|...||........|.|..|..:    |:|..|....:..|.....
Mouse   262 LEDNIVTFHCSAKANPAVTQYRWAKRGHIIKEASGELYRTTVDYTYFSEPVSCEVTNALGSTNLS 326

  Fly   402 SAV----RRNLTMPVLNITAQMGNHAYMPCQIHRLSDKPVSWVRMRDNHIISVDETTFIADERFQ 462
            ..|    ...:|....::...:|:.|...|.........:.|::.....::|.::|         
Mouse   327 RTVDVYFGPRMTSEPQSLLVDLGSDAVFSCAWIGNPSLTIVWMKRGSGVVLSNEKT--------- 382

  Fly   463 SIYQEDHDYTWSLQIKYVEPSDAGWYECQMATEPKLSA---KVHLQIVKPKTELIGDQSRFVKAG 524
                        |.:|.|...|||.|.|: |..|::.|   :|.|.:..|.. :...|::....|
Mouse   383 ------------LTLKSVRQEDAGKYVCR-AVVPRVGAGEREVTLTVNGPPI-ISSTQTQHALHG 433

  Fly   525 SKVALHCIVRGTLDPPKYIIWFRGQKKISDSDERTGWYTQLDRNIFGTVGDNQNTIGSLIIP-LV 588
            .|..:.|.:|.| .||..|.| ..::.:.:|. .:|.||      ..||...:..|.:|.|. :|
Mouse   434 EKGQIKCFIRST-PPPDRIAW-SWKENVLESG-TSGRYT------VETVNTEEGVISTLTISNIV 489

  Fly   589 RKEDSGNYTCQPSNSVSVSVDL 610
            |.:....|.|...||.....::
Mouse   490 RADFQTIYNCTAWNSFGSDTEI 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr17NP_001287297.1 IG_like 414..491 CDD:214653 13/76 (17%)
Ig 415..507 CDD:299845 19/94 (20%)
IG_like 521..612 CDD:214653 24/91 (26%)
IGc2 524..605 CDD:197706 24/81 (30%)
Kirrel3XP_006510620.1 IG_like 54..143 CDD:214653
Ig strand A' 56..60 CDD:409353
Ig strand B 64..71 CDD:409353
Ig strand C 78..82 CDD:409353
Ig strand C' 84..87 CDD:409353
Ig strand D 97..101 CDD:409353
Ig strand E 104..116 CDD:409353
Ig strand G 132..143 CDD:409353
IgI_2_KIRREL3-like 149..246 CDD:409416 8/48 (17%)
Ig strand B 166..170 CDD:409416
Ig strand C 180..184 CDD:409416
Ig strand E 210..214 CDD:409416 2/3 (67%)
Ig strand F 224..229 CDD:409416 0/4 (0%)
Ig strand G 239..242 CDD:409416 0/2 (0%)
Ig <267..334 CDD:416386 13/66 (20%)
Ig strand B 267..274 CDD:409353 0/6 (0%)
Ig strand C 279..286 CDD:409353 1/6 (17%)
Ig strand C' 288..291 CDD:409353 0/2 (0%)
Ig strand D 298..302 CDD:409353 1/3 (33%)
Ig strand E 304..310 CDD:409353 1/5 (20%)
Ig strand G 321..334 CDD:409353 2/12 (17%)
Ig 335..416 CDD:416386 20/102 (20%)
Ig strand A' 343..347 CDD:409353 0/3 (0%)
Ig strand B 350..360 CDD:409353 2/9 (22%)
Ig strand C 365..371 CDD:409353 1/5 (20%)
Ig strand E 381..387 CDD:409353 2/26 (8%)
IgI_5_KIRREL3 418..515 CDD:409479 26/104 (25%)
Ig strand B 436..440 CDD:409479 0/3 (0%)
Ig strand C 450..454 CDD:409479 2/4 (50%)
Ig strand E 481..485 CDD:409479 1/3 (33%)
Ig strand F 496..501 CDD:409479 2/4 (50%)
Ig strand G 509..512 CDD:409479 0/3 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.