DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr17 and nitr4a

DIOPT Version :9

Sequence 1:NP_001287297.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_571729.1 Gene:nitr4a / 60652 ZFINID:ZDB-GENE-001106-11 Length:337 Species:Danio rerio


Alignment Length:271 Identity:63/271 - (23%)
Similarity:101/271 - (37%) Gaps:67/271 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   405 RRNLTMPVLN--ITAQMGNHAYMPC-----QIHR-------LSDKPV----SWVRMRDNHIISVD 451
            :.|.|:..::  :|.|.|:...:||     ..||       |.:|||    |:...:.|...|  
Zfish    19 KNNCTVDQVDEVLTTQEGHIVLLPCLLLEDNFHRVIWYKQVLGEKPVVIVSSYHHSQPNEFSS-- 81

  Fly   452 ETTFIADERFQSIYQEDHDYTWSLQIKYVEPSDAGWYECQMATEPKLS-----------AKVHLQ 505
              .|...:||.::.:.|   :::|.|:....||:|.|.|..|....:|           |.:...
Zfish    82 --DFKETQRFHAVRKAD---SFNLTIRRTLKSDSGTYFCGSAFTHVVSFGTGTILLVKGADLKPA 141

  Fly   506 IVKPKTELIGDQSRFVKAGSKVALHCIVRG-TLDP-PKYIIWFRGQKKISDSDERTG-WYTQ-LD 566
            :::.....:      :|.||.|.|.|.|.| |.|. .:.:.|||.    |.|....| .||. ..
Zfish   142 VIQLPVHAV------IKPGSNVTLRCSVEGKTCDKGVQSVYWFRQ----SSSTTHQGIVYTHGKS 196

  Fly   567 RNIFGTVGDNQNTIGSLIIPLVRKEDSGNYTCQ-----------------PSNSVSVSVDLHVLS 614
            :|......|.|:.:.:|....|...::|.|.|.                 ....:|.|:...:|.
Zfish   197 KNECADSSDTQSCLQNLAKMSVNVSEAGLYYCSVVTCDEVLFGNGTTLVIKDGFISESIQKCILI 261

  Fly   615 GEYSASAIMST 625
            |....||:..|
Zfish   262 GLTVLSAVSLT 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr17NP_001287297.1 IG_like 414..491 CDD:214653 24/94 (26%)
Ig 415..507 CDD:299845 28/118 (24%)
IG_like 521..612 CDD:214653 28/111 (25%)
IGc2 524..605 CDD:197706 25/101 (25%)
nitr4aNP_571729.1 Ig 24..134 CDD:299845 27/116 (23%)
IG_like 29..127 CDD:214653 27/104 (26%)
V-set 144..246 CDD:284989 26/111 (23%)
IG_like 146..246 CDD:214653 26/109 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1457433at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.