DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr17 and nitr3a

DIOPT Version :9

Sequence 1:NP_001287297.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_571727.1 Gene:nitr3a / 60649 ZFINID:ZDB-GENE-001106-8 Length:337 Species:Danio rerio


Alignment Length:242 Identity:49/242 - (20%)
Similarity:81/242 - (33%) Gaps:67/242 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   415 ITAQMGNHAYMPCQIHRLSD---KPVSWVRMRDNHIISVDETTFIADERFQS---IYQEDHDYT- 472
            :.|::|:...:|| .|  ||   ..|||.:..     |..:...||...|.|   .||...:.| 
Zfish    30 VVAELGSRVTLPC-FH--SDDYVTTVSWTKHS-----SGKKPLLIAYSDFNSERVTYQNAFNNTN 86

  Fly   473 ----------WSLQIKYVEPSDAGWYECQMATEPKLSAKVHLQIVKPKTELIGDQSRF------- 520
                      ::|.|.::|..|...|.|......:|.......:::.:|:.|...|..       
Zfish    87 RFFITIASGCYNLTILHLEKEDFANYYCVKDFLNRLMFGEGTILLRKETDRISSTSVIQQPVSDR 151

  Fly   521 VKAGSKVALHCIVRGTLDPPKY-IIWFRGQKKISD----------------SDERTGWYTQLDRN 568
            :..|..|.|.|.|...:....| :.||:.....|.                |.|::.:.      
Zfish   152 LHPGDSVTLQCSVSSHICAGHYRVYWFKHSSGYSQPGIIYTHDNRSDQCLKSSEKSSFV------ 210

  Fly   569 IFGTVGDNQNTIGSLIIPLVRKEDSGNYTCQPSNSVSVSVDLHVLSG 615
                    |:.:.||....:...|:|.|.|    :|.....:|..:|
Zfish   211 --------QSCVYSLSQTELTTSDAGVYYC----AVDTCGKIHFGNG 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr17NP_001287297.1 IG_like 414..491 CDD:214653 23/92 (25%)
Ig 415..507 CDD:299845 25/108 (23%)
IG_like 521..612 CDD:214653 19/107 (18%)
IGc2 524..605 CDD:197706 18/97 (19%)
nitr3aNP_571727.1 V-set 26..130 CDD:284989 25/107 (23%)
IG_like 27..132 CDD:214653 25/109 (23%)
V-set 145..250 CDD:284989 21/119 (18%)
IG_like 154..250 CDD:214653 21/110 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1457433at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.