DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr17 and nitr2b

DIOPT Version :9

Sequence 1:NP_001287297.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_571724.1 Gene:nitr2b / 60647 ZFINID:ZDB-GENE-001106-6 Length:313 Species:Danio rerio


Alignment Length:233 Identity:52/233 - (22%)
Similarity:79/233 - (33%) Gaps:52/233 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   390 LAAHRDGGDGAGSAVRRNLTMPVLNITAQMGNHAYMPCQIHRLSDKPVSWVRMRDNHIISVDETT 454
            |....|..|..|    :|..|.|     |.|....:.|...:.|...|.||:.|      |.|..
Zfish    13 LTCTSDNADIKG----QNHVMIV-----QAGVAVNLTCIFPKESRTSVVWVKQR------VGEKP 62

  Fly   455 FIADERFQSI---YQEDHDY-----------TWSLQIKYVEPSDAGWYECQMATEPKLSAKVHLQ 505
            .:....:|.:   |:.|.|.           :::|.|...|.||...|.|        .|.|:..
Zfish    63 LLIASAYQGLAGKYENDFDKQNRFFIEKDEGSFNLSIANTEISDTATYYC--------VAYVYEF 119

  Fly   506 IVKPKTELIGD------QSRFVKAGSKVALHCIVRGTLDPPKYIIWFRGQKKISDSDERTGW--Y 562
            |....|:||.:      :|...::.|:.....::..:......:.|||     ..|.|.:..  |
Zfish   120 IFGNSTDLIVNAGKLNIKSEHQRSASEDQQCSVISQSCAEEHKVYWFR-----QGSGESSPGVIY 179

  Fly   563 TQLDRNIFGTVGDNQNTIGSLIIPLVRK--EDSGNYTC 598
            ||..|:.......:.|:.....|..:.|  ||...|.|
Zfish   180 TQNSRSAQCEKSSDLNSTAHKCIYSLPKTDEDPAIYYC 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr17NP_001287297.1 IG_like 414..491 CDD:214653 20/90 (22%)
Ig 415..507 CDD:299845 23/105 (22%)
IG_like 521..612 CDD:214653 17/82 (21%)
IGc2 524..605 CDD:197706 17/79 (22%)
nitr2bNP_571724.1 IG_like 28..129 CDD:214653 28/119 (24%)
IgV 29..129 CDD:143167 28/118 (24%)
Ig 149..232 CDD:299845 16/74 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1457433at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.