| Sequence 1: | NP_001287297.1 | Gene: | dpr17 / 41470 | FlyBaseID: | FBgn0051361 | Length: | 664 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001097508.2 | Gene: | DIP-delta / 5740816 | FlyBaseID: | FBgn0085420 | Length: | 469 | Species: | Drosophila melanogaster |
| Alignment Length: | 270 | Identity: | 63/270 - (23%) |
|---|---|---|---|
| Similarity: | 97/270 - (35%) | Gaps: | 54/270 - (20%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 411 PVLNITAQMGNHAYMPCQIHRLSDKPVSWVRMRDNHIISVDETTFIADERFQSIYQEDHDYTWSL 475
Fly 476 QIKYVEPSDAGWYECQMATEPKLSAKVHLQIVKPKTEL---IGDQSRFVKAGSKVALHCIVRGTL 537
Fly 538 DPPKYIIWFRG-------QKK----ISDSDERTGWYTQLDRNIFGTVGDNQNTIGSLIIPL--VR 589
Fly 590 KEDSGNYTCQPSNSVSVSVDLH-VLSGEYSASAIMSTAARTTKGGRST---CHSTLGLLGILGLL 650
Fly 651 WAMQGAMHTP 660 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| dpr17 | NP_001287297.1 | IG_like | 414..491 | CDD:214653 | 19/76 (25%) |
| Ig | 415..507 | CDD:299845 | 25/91 (27%) | ||
| IG_like | 521..612 | CDD:214653 | 22/104 (21%) | ||
| IGc2 | 524..605 | CDD:197706 | 18/93 (19%) | ||
| DIP-delta | NP_001097508.2 | IG | 51..143 | CDD:214652 | 26/94 (28%) |
| Ig | 145..238 | CDD:416386 | 25/121 (21%) | ||
| Ig strand A | 145..149 | CDD:409353 | 0/3 (0%) | ||
| Ig strand A' | 154..159 | CDD:409353 | 1/4 (25%) | ||
| Ig strand B | 165..172 | CDD:409353 | 1/6 (17%) | ||
| Ig strand C | 178..183 | CDD:409353 | 3/4 (75%) | ||
| Ig strand C' | 185..187 | CDD:409353 | 0/1 (0%) | ||
| Ig strand D | 195..199 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 203..209 | CDD:409353 | 3/32 (9%) | ||
| Ig strand F | 216..223 | CDD:409353 | 3/6 (50%) | ||
| Ig strand G | 230..238 | CDD:409353 | 2/7 (29%) | ||
| Ig | 242..333 | CDD:416386 | 7/45 (16%) | ||
| Ig strand A' | 250..253 | CDD:409353 | 0/2 (0%) | ||
| Ig strand B | 259..266 | CDD:409353 | 2/6 (33%) | ||
| Ig strand C | 272..277 | CDD:409353 | 2/6 (33%) | ||
| Ig strand C' | 281..283 | CDD:409353 | 1/1 (100%) | ||
| Ig strand D | 289..293 | CDD:409353 | |||
| Ig strand E | 295..305 | CDD:409353 | |||
| Ig strand F | 314..322 | CDD:409353 | |||
| Ig strand G | 325..334 | CDD:409353 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 1 | 1.000 | 45 | 1.000 | Domainoid score | I12107 |
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.810 | |||||