DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr17 and DIP-delta

DIOPT Version :10

Sequence 1:NP_731670.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster


Alignment Length:270 Identity:63/270 - (23%)
Similarity:97/270 - (35%) Gaps:54/270 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   411 PVLNITAQMGNHAYMPCQIHRLSDKPVSWVRMRDNHIISVDETTFIADERFQSIYQEDHDYTWSL 475
            |:.|:|..:|..|.:||.:..|....|:|:.:....|:::.........|:...|.   |.||.|
  Fly    49 PIPNVTVAVGRDANLPCVVEHLGGYKVAWIHIDRQMILTIHRHVISRIPRYSITYT---DNTWLL 110

  Fly   476 QIKYVEPSDAGWYECQMATEPKLSAKVHLQIVKPKTEL---IGDQSRFVKAGSKVALHCIVRGTL 537
            .:......|.|:|.||:.|.|.:|...:||:|.|...|   ....|..|:....:.:.|...|. 
  Fly   111 HVNQAHQDDRGYYMCQVNTNPMISQVGYLQVVVPPNILDIESTPSSVAVRENQNINMTCRADGF- 174

  Fly   538 DPPKYIIWFRG-------QKK----ISDSDERTGWYTQLDRNIFGTVGDNQNTIGSLIIPL--VR 589
             |...|||.|.       :||    :.|:|                           ::||  |.
  Fly   175 -PAPKIIWRREDGEEIAVEKKKKVLVYDAD---------------------------VLPLTKVS 211

  Fly   590 KEDSGNYTCQPSNSVSVSVDLH-VLSGEYSASAIMSTAARTTKGGRST---CHSTLGLLGILGLL 650
            :.:.|.|.|..:|.|..||... :|..|:|....:.........|...   ||:......|  :.
  Fly   212 RNEMGAYLCIATNGVPPSVSKRIILDVEFSPMIWVPNQLVGAPSGTDVTIDCHTEAHPKAI--IY 274

  Fly   651 WAMQGAMHTP 660
            |.....|..|
  Fly   275 WVYNSVMVLP 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr17NP_731670.1 V-set 415..507 CDD:462230 25/91 (27%)
IG_like 521..612 CDD:214653 22/104 (21%)
Ig strand B 527..531 CDD:409353 0/3 (0%)
Ig strand C 542..546 CDD:409353 2/3 (67%)
Ig strand E 581..585 CDD:409353 0/3 (0%)
Ig strand F 595..600 CDD:409353 2/4 (50%)
DIP-deltaNP_001097508.2 IG_like 51..143 CDD:214653 26/94 (28%)
Ig strand B 61..65 CDD:409353 1/3 (33%)
Ig strand C 74..78 CDD:409353 1/3 (33%)
Ig strand E 105..112 CDD:409353 4/6 (67%)
Ig strand F 122..127 CDD:409353 2/4 (50%)
Ig strand G 134..137 CDD:409353 1/2 (50%)
Ig 145..238 CDD:472250 25/121 (21%)
Ig strand B 165..169 CDD:409353 0/3 (0%)
Ig strand C 178..182 CDD:409353 2/3 (67%)
Ig strand E 203..207 CDD:409353 1/30 (3%)
Ig strand F 217..222 CDD:409353 2/4 (50%)
Ig strand G 231..234 CDD:409353 0/2 (0%)
Ig 242..333 CDD:472250 7/45 (16%)
Ig strand B 259..263 CDD:409353 0/3 (0%)
Ig strand C 272..276 CDD:409353 1/5 (20%)
Ig strand E 295..305 CDD:409353
Ig strand F 315..320 CDD:409353
Ig strand G 328..331 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.