DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr17 and CG34353

DIOPT Version :9

Sequence 1:NP_001287297.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_001287571.1 Gene:CG34353 / 5740590 FlyBaseID:FBgn0085382 Length:581 Species:Drosophila melanogaster


Alignment Length:466 Identity:96/466 - (20%)
Similarity:159/466 - (34%) Gaps:175/466 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   338 LPAYRAAADAAEAAKLAAEAAAQ--AAAAKTSSEAVTMS-PEEQR-RQMFNEQH------SYLAA 392
            ||...:::.:..|.|....:.::  :...|.::||.|:| |...| |::.:..|      :.::.
  Fly     6 LPTRSSSSSSRIAYKFECHSNSKQNSKTGKMAAEARTISKPGHIRDRRVGSLPHILFLAIAVVSL 70

  Fly   393 HRDGGDGAGSAVRRNLTMPVLN------ITAQMGNHAYMPCQIHRLSDKPVSWVRMRDNHIISVD 451
            |.: ...|.|.:.:|..|.:..      ||   |....:||::.......|:|  .|...|::..
  Fly    71 HFE-SVSAQSMMTKNEPMFISRSETFKFIT---GETIVLPCEVANTDTYVVAW--KRGIAILTAG 129

  Fly   452 ETTFIADERFQSIYQEDHDYTWSLQIKYVEPSDAGWYECQMAT-EPK-LSAKVHLQIVKPKTELI 514
            ......|.|.:.:      ..::|||:...|:|||.|.||:|| :|: ::..|.: :|.|:...|
  Fly   130 SVKVTPDPRVRLV------NGFNLQIRDALPTDAGDYICQIATMDPREITHTVEI-LVPPRIHHI 187

  Fly   515 GDQSRF-VKAGSKVALHCIVRGTLDPPKYIIWFR-------GQKK-------------------I 552
            ...... ||.||.|.:.|...|  :|...:.|.|       |::|                   |
  Fly   188 STGGHLQVKKGSSVRIECSATG--NPMPNVTWSRKNNILPNGEEKLHSHVLSIENVDRHKGGVYI 250

  Fly   553 SDSDERTG-----------------------------------------------WY---TQLD- 566
            ..::.|.|                                               |:   .||| 
  Fly   251 CTANNRVGQPASSQVVLHVLFSPEISVERPVVFSGEGHEATLVCIVHGETQPEVIWFKDTMQLDT 315

  Fly   567 --RNIFGTVGDNQNTIGSLIIPLVRKEDSGNYTCQPSN--------------------------- 602
              |:|..|.|...    :|||..|..:|.|||:|...|                           
  Fly   316 TERHIMETRGSRH----TLIIRKVHPQDFGNYSCVAENQLGKARKTLQLSGKPNVAVFNSPPISQ 376

  Fly   603 -----SVSVSVDLHVLSGEY---------------------SASAIMSTAARTTKGGRSTCH--- 638
                 ::|.:||.|....||                     |:|:.||:::....|.....|   
  Fly   377 YKDRYNISWAVDSHSPIEEYKLSFRKLPQGHEVVGNAIDSSSSSSSMSSSSSQMYGSGLHAHRIG 441

  Fly   639 STLGLLGILGL 649
            |.:|  |:.||
  Fly   442 SNMG--GLSGL 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr17NP_001287297.1 IG_like 414..491 CDD:214653 19/82 (23%)
Ig 415..507 CDD:299845 25/93 (27%)
IG_like 521..612 CDD:214653 36/201 (18%)
IGc2 524..605 CDD:197706 31/191 (16%)
CG34353NP_001287571.1 IG_like 100..180 CDD:214653 23/88 (26%)
Ig 103..177 CDD:143165 21/81 (26%)
IG_like 191..269 CDD:214653 15/79 (19%)
IGc2 198..258 CDD:197706 12/61 (20%)
I-set 273..360 CDD:254352 18/90 (20%)
Ig 290..359 CDD:143165 18/72 (25%)
FN3 <466..524 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.