DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr17 and dscama

DIOPT Version :9

Sequence 1:NP_001287297.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster
Sequence 2:XP_021334866.1 Gene:dscama / 568643 ZFINID:ZDB-GENE-050310-7 Length:2025 Species:Danio rerio


Alignment Length:277 Identity:62/277 - (22%)
Similarity:106/277 - (38%) Gaps:67/277 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   388 SYL-AAH---RDGG-------DGAGSA---VRRNL-----TMPVLNITAQMGNHAYMPCQIHRLS 433
            ||| .:|   ||.|       :.||:.   .|.|:     ..|:.|:||..|...|:.|.:....
Zfish   468 SYLNISHIQVRDSGVYRCTCNNSAGTVSYQARINVRGSADIRPMKNLTAIAGWDMYIHCHVIGYP 532

  Fly   434 DKPVSWVRMRDNHIISVDETTFIADERFQSIYQEDHDYTWSLQIKYVEPS-DAGWYECQMATEPK 497
            ...:.|  .::::::..::.            |...:...:|::..|:.. |.|.|.|.:..:|:
Zfish   533 YYSIKW--FKNSNLLPFNDR------------QRAFENNGTLKLLNVQKELDEGEYSCHVQVQPQ 583

  Fly   498 L--SAKVHLQIVKPKTELIGDQSRFVKAGSKVALHCIVRGTLDPPKYIIWFRGQKKISDSDERTG 560
            |  :..||:.:..|......:..|: ..|.:|.:.|:||.. |.|..|.|.:..|.|:.|     
Zfish   584 LFKNQSVHVTVKVPPFIQPFEFPRY-SIGHRVFVPCVVRSG-DLPISITWEKDGKSINAS----- 641

  Fly   561 WYTQLDRNIFGTVGDNQNTIGSLIIPLVRKEDSGNYTCQPSNSVSV---------------SVDL 610
                     .|...||.:...||.|..:::..:|.|||...|..:|               .|..
Zfish   642 ---------LGVTIDNIDFTSSLRISNLQRVHNGTYTCIAQNDAAVVKYQSQLIVRVPPRFKVQP 697

  Fly   611 HVLSGEYSASAIMSTAA 627
            ....|.|..|.|::.:|
Zfish   698 QDQDGIYGKSVILNCSA 714

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr17NP_001287297.1 IG_like 414..491 CDD:214653 13/77 (17%)
Ig 415..507 CDD:299845 17/94 (18%)
IG_like 521..612 CDD:214653 25/105 (24%)
IGc2 524..605 CDD:197706 23/80 (29%)
dscamaXP_021334866.1 Ig 124..217 CDD:325142
I-set 236..311 CDD:254352
IG_like 321..402 CDD:214653
I-set 408..502 CDD:333254 10/33 (30%)
IGc2 524..579 CDD:197706 9/68 (13%)
Ig 614..679 CDD:319273 22/79 (28%)
Ig_DSCAM 708..787 CDD:143211 2/7 (29%)
Ig 805..898 CDD:325142
FN3 894..988 CDD:238020
FN3 995..1092 CDD:238020
fn3 1100..1186 CDD:306538
fn3 1199..1282 CDD:306538
Ig 1312..1377 CDD:319273
fn3 1405..1471 CDD:306538
FN3 1492..1563 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.