DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr17 and pvrl2l

DIOPT Version :10

Sequence 1:NP_731670.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_001417821.1 Gene:pvrl2l / 560933 ZFINID:ZDB-GENE-060503-249 Length:508 Species:Danio rerio


Alignment Length:211 Identity:48/211 - (22%)
Similarity:68/211 - (32%) Gaps:70/211 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 WSQKSSSSWSSTSRRTGISRTRTRPATLTTEMTVAGRAERAGVGAPWCRRFFHTSPLASWL---- 97
            |||:....:..|:...|       ...|..|.|.:|..:...|               ||:    
Zfish    24 WSQRVRVEYEVTAYPNG-------SVNLRCEFTNSGTTKLTQV---------------SWMFERA 66

  Fly    98 ---RISFVLLVLPALGFGIQVVTCSNPELGASAPDPVDLTWGGKNTEGQLTTAT----------- 148
               |               |.:...:|:.|||.|:. |.....|.|:|.|...:           
Zfish    67 ENDR---------------QNIAVFHPQYGASFPNK-DFEGRVKFTQGSLENPSIRIDKLRMADA 115

  Fly   149 ------RSTLP--DSPMTTQNDLITTASNLATAKKPATAASEAVVDTAETAETAPPTEATSSWSS 205
                  .:|.|  :...||...::....|.|||.......||.||.|...|:..|  |||.||.:
Zfish   116 GRYICEYATYPSGNEQGTTTLIMLAKPKNSATAIPVRAGTSEVVVATCAAAQGKP--EATISWIT 178

  Fly   206 TAVAR----GMSSADG 217
            |...|    .:..:||
Zfish   179 TITGRYNHTSVPESDG 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr17NP_731670.1 V-set 415..507 CDD:462230
IG_like 521..612 CDD:214653
Ig strand B 527..531 CDD:409353
Ig strand C 542..546 CDD:409353
Ig strand E 581..585 CDD:409353
Ig strand F 595..600 CDD:409353
pvrl2lNP_001417821.1 IgV_1_PVR_like 26..138 CDD:409383 26/149 (17%)
FR1 26..49 CDD:409383 5/29 (17%)
Ig strand A 26..30 CDD:409383 1/3 (33%)
Ig strand A' 32..36 CDD:409383 0/3 (0%)
Ig strand B 41..49 CDD:409383 2/7 (29%)
CDR1 50..56 CDD:409383 1/5 (20%)
FR2 57..63 CDD:409383 3/20 (15%)
Ig strand C 58..63 CDD:409383 3/19 (16%)
CDR2 64..84 CDD:409383 5/34 (15%)
Ig strand C' 74..79 CDD:409383 0/4 (0%)
Ig strand C' 81..85 CDD:409383 3/3 (100%)
FR3 85..122 CDD:409383 6/37 (16%)
Ig strand D 93..96 CDD:409383 1/2 (50%)
Ig strand E 102..109 CDD:409383 0/6 (0%)
Ig strand F 116..124 CDD:409383 0/7 (0%)
CDR3 125..128 CDD:409383 1/2 (50%)
Ig strand G 128..138 CDD:409383 2/9 (22%)
FR4 129..138 CDD:409383 2/8 (25%)
IgC1_2_Nectin-2_Necl-5_like 142..237 CDD:409500 20/55 (36%)
Ig strand A 142..148 CDD:409500 2/5 (40%)
Ig strand B 159..166 CDD:409500 3/6 (50%)
Ig strand C 171..177 CDD:409500 4/5 (80%)
Ig strand C' 179..181 CDD:409500 1/1 (100%)
Ig strand D 184..192 CDD:409500 0/7 (0%)
Ig strand E 196..204 CDD:409500
Ig strand F 214..221 CDD:409500
Ig strand G 227..233 CDD:409500
Ig 240..325 CDD:472250
Ig strand B 258..262 CDD:409524
Ig strand C 272..276 CDD:409524
Ig strand E 291..295 CDD:409524
Ig strand F 305..310 CDD:409524
Ig strand G 320..323 CDD:409524
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.