DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr17 and igsf9a

DIOPT Version :9

Sequence 1:NP_001287297.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster
Sequence 2:XP_005155702.1 Gene:igsf9a / 557459 ZFINID:ZDB-GENE-060503-288 Length:1619 Species:Danio rerio


Alignment Length:390 Identity:81/390 - (20%)
Similarity:123/390 - (31%) Gaps:145/390 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   353 LAAEAAAQAAAAKT---SSEAVTMSPEEQRRQMFNEQHSYLAAHRD----------GGDGAGSAV 404
            |..:.|||.....|   |.:...:.| :.:.:|.|...|:.|..|:          ..:|..:.|
Zfish   154 LTLKCAAQGNPRPTITWSKDGAPIKP-QHKVKMVNGSVSFHAVSREAAGQYQCYTSNSEGNATHV 217

  Fly   405 RR-------NLTMPVLNITAQMGNHAYMPCQIHRLSDKPVSWVRMRDNHIISVDETTFIADERFQ 462
            .|       .:.:|..:....|...|.:.||..  :|.|               ..|::...:..
Zfish   218 TRLKIIGPPVIIIPPSDTVLNMSQDAKLKCQAE--ADPP---------------NMTYVWQRQGV 265

  Fly   463 SIYQEDH---------DYTWSLQIKYVEPSDAGWYECQ----MATEPKLSAKVHLQ-----IVKP 509
            .||..|.         |.|  |.|..:.|.|:|.|.|.    :...|..||.:.:|     |..|
Zfish   266 DIYHIDSLKSRIKVIVDGT--LLISRLAPEDSGNYTCMPTNGLPVSPSASAVLTVQHPAQVIQMP 328

  Fly   510 KTELIGDQSRFVKAGSKVALHCIVRGTLDPP-KYIIWFRGQKKI-----------SD-------- 554
            |.       .|:..|.:.|:.|.||.  :|| .:|.|.:..|.:           ||        
Zfish   329 KL-------TFLPTGMRGAIVCPVRA--EPPLSHIDWIKDGKPLDLGMYPGWTLASDGSIVIATV 384

  Fly   555 SDERTGWYTQLDRNIFGTVGDNQNTI--------------------------------------- 580
            :|:..|.|.....|.|||.|.::.|.                                       
Zfish   385 NDDAAGVYICTPYNSFGTTGQSEPTTVILQDPPSFKVSPRNEYRQDVGTMLVIPCQMVGNPAPKV 449

  Fly   581 ------------------GSLIIPLVRKEDSGNYTCQPSNSV-SVSVDLHVLSGEYSASAIMSTA 626
                              ||||:..:.|:..|.:.|..||.| :||:...||....|..|:.|.:
Zfish   450 NWRKIGAATRSLFTLAGNGSLILHPLSKDHQGEWECSSSNRVATVSIKTMVLVLGTSPHAVSSVS 514

  Fly   627  626
            Zfish   515  514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr17NP_001287297.1 IG_like 414..491 CDD:214653 18/85 (21%)
Ig 415..507 CDD:299845 23/109 (21%)
IG_like 521..612 CDD:214653 33/168 (20%)
IGc2 524..605 CDD:197706 31/158 (20%)
igsf9aXP_005155702.1 IG_like 27..110 CDD:214653
Ig 35..111 CDD:299845
I-set 140..221 CDD:254352 15/67 (22%)
IGc2 151..212 CDD:197706 12/58 (21%)
Ig 233..318 CDD:299845 22/103 (21%)
I-set 233..318 CDD:254352 22/103 (21%)
Ig <349..402 CDD:299845 12/52 (23%)
IG_like 423..502 CDD:214653 13/78 (17%)
Ig 435..498 CDD:143165 12/62 (19%)
FN3 507..602 CDD:238020 2/8 (25%)
fn3 614..696 CDD:278470
PHA02666 1105..>1312 CDD:222914
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.