DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr17 and Ntm

DIOPT Version :10

Sequence 1:NP_731670.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_001418383.1 Gene:Ntm / 50864 RGDID:620958 Length:367 Species:Rattus norvegicus


Alignment Length:321 Identity:71/321 - (22%)
Similarity:118/321 - (36%) Gaps:89/321 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   414 NITAQMGNHAYMPCQIHRLSDKPVSWVRMRDNHIISVDETTFIADERFQSIYQEDHDYTWSLQIK 478
            |:|.:.|..|.:.|.|.....: |:|  :..:.|:......:..|.|...:......|  |::|:
  Rat    44 NVTVRQGESATLRCTIDNRVTR-VAW--LNRSTILYAGNDKWCLDPRVVLLSNTQTQY--SIEIQ 103

  Fly   479 YVEPSDAGWYECQMATE--PKLSAKVHLQI-VKPK-TELIGDQSRFVKAGSKVALHCIVRGTLDP 539
            .|:..|.|.|.|.:.|:  ||.| :|||.: |.|| .|:..|.|  :..|:.::|.||..|..:|
  Rat   104 NVDVYDEGPYTCSVQTDNHPKTS-RVHLIVQVSPKIVEISSDIS--INEGNNISLTCIATGRPEP 165

  Fly   540 --------PKYIIWF---------------RGQKKISDSDE-----------------------R 558
                    ||.:.:.               .|:.:.|.|::                       .
  Rat   166 TVTWRHISPKAVGFVSEDEYLEIQGITREQSGEYECSASNDVAAPVVRRVKVTVNYPPYISEAKG 230

  Fly   559 TG----------------------WYTQLDRNIFGTVG---DNQNTIGSLIIPLVRKEDSGNYTC 598
            ||                      |:....|.:.|..|   :|:..:..|....|.:.|.|||||
  Rat   231 TGVPVGQKGTLQCEASAVPSAEFQWFKDDKRLVEGKKGVKVENRPFLSRLTFFNVSEHDYGNYTC 295

  Fly   599 QPSNSV---SVSVDLHVLSGEYSAS---AIMSTAARTTKGGRSTCHSTLGLLGILGLLWAM 653
            ..||.:   :.|:.|..|:...|::   .:.:||....||..:......|.....|.:|.:
  Rat   296 VASNKLGHTNASIMLFELNEPTSSTLLQEVKTTALTPWKGPGAVSEVNNGTSRRAGCIWLL 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr17NP_731670.1 V-set 415..507 CDD:462230 25/94 (27%)
IG_like 521..612 CDD:214653 30/164 (18%)
Ig strand B 527..531 CDD:409353 1/3 (33%)
Ig strand C 542..546 CDD:409353 0/3 (0%)
Ig strand E 581..585 CDD:409353 1/3 (33%)
Ig strand F 595..600 CDD:409353 4/4 (100%)
NtmNP_001418383.1 Ig 44..132 CDD:472250 26/93 (28%)
Ig strand B 53..57 CDD:409382 1/3 (33%)
Ig strand C 65..69 CDD:409382 2/6 (33%)
Ig strand E 98..102 CDD:409382 2/5 (40%)
Ig strand F 112..117 CDD:409382 2/4 (50%)
Ig strand G 125..128 CDD:409382 1/3 (33%)
Ig_3 136..205 CDD:464046 15/70 (21%)
Ig 223..307 CDD:472250 17/83 (20%)
Ig strand B 239..243 CDD:409408 0/3 (0%)
Ig strand C 252..256 CDD:409408 0/3 (0%)
Ig strand E 278..282 CDD:409408 1/3 (33%)
Ig strand F 292..297 CDD:409408 4/4 (100%)

Return to query results.
Submit another query.