DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr17 and OPCML

DIOPT Version :10

Sequence 1:NP_731670.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_001306032.1 Gene:OPCML / 4978 HGNCID:8143 Length:354 Species:Homo sapiens


Alignment Length:321 Identity:70/321 - (21%)
Similarity:117/321 - (36%) Gaps:98/321 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   414 NITAQMGNHAYMPCQIHRLSDK--PVSWVRMRDNHIISVDETTFIADERFQSIYQEDHDYTWSLQ 476
            |:|.:.|..|.:.|.|   .|:  .|:|  :..:.|:......:..|.|...:......|  |:.
Human    44 NVTVRQGESATLRCTI---DDRVTRVAW--LNRSTILYAGNDKWSIDPRVIILVNTPTQY--SIM 101

  Fly   477 IKYVEPSDAGWYECQMATE--PKLSAKVHLQIVKPKTELIGDQSRF-VKAGSKVALHCIVRGTLD 538
            |:.|:..|.|.|.|.:.|:  ||.| :||| ||:...:::...|.. |..||.|.|.|:..|..:
Human   102 IQNVDVYDEGPYTCSVQTDNHPKTS-RVHL-IVQVPPQIMNISSDITVNEGSSVTLLCLAIGRPE 164

  Fly   539 PPKYIIW-----FRGQKKISDSD------------------------------------------ 556
            |.  :.|     ..||..:|:.:                                          
Human   165 PT--VTWRHLSVKEGQGFVSEDEYLEISDIKRDQSGEYECSALNDVAAPDVRKVKITVNYPPYIS 227

  Fly   557 --ERTG----------------------WY---TQLDRNIFGTVGDNQNTIGSLIIPLVRKEDSG 594
              :.||                      |:   |:|...:.|...:|:..:.:|....|.::|.|
Human   228 KAKNTGVSVGQKGILSCEASAVPMAEFQWFKEETRLATGLDGMRIENKGRMSTLTFFNVSEKDYG 292

  Fly   595 NYTCQPSN---SVSVSVDLHVLSGEYSASAIMSTAARTTKGGRSTCHSTLGLLGILGLLWA 652
            ||||..:|   :.:.|:.|:.:|   .:||:....|  ...|.::....|..|.:.|.|.|
Human   293 NYTCVATNKLGNTNASITLYEIS---PSSAVAGPGA--VIDGVNSASRALACLWLSGTLLA 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr17NP_731670.1 V-set 415..507 CDD:462230 26/95 (27%)
IG_like 521..612 CDD:214653 30/167 (18%)
Ig strand B 527..531 CDD:409353 2/3 (67%)
Ig strand C 542..546 CDD:409353 1/8 (13%)
Ig strand E 581..585 CDD:409353 1/3 (33%)
Ig strand F 595..600 CDD:409353 4/4 (100%)
OPCMLNP_001306032.1 Ig 44..132 CDD:472250 27/96 (28%)
Ig strand B 53..57 CDD:409353 1/3 (33%)
Ig strand C 65..69 CDD:409353 2/5 (40%)
Ig strand E 98..102 CDD:409353 2/5 (40%)
Ig strand F 112..117 CDD:409353 2/4 (50%)
Ig strand G 125..128 CDD:409353 1/3 (33%)
Ig_3 135..206 CDD:464046 13/72 (18%)
Ig 224..312 CDD:472250 17/87 (20%)
Ig strand B 240..244 CDD:409353 0/3 (0%)
Ig strand C 253..257 CDD:409353 0/3 (0%)
Ig strand E 279..283 CDD:409353 1/3 (33%)
Ig strand F 293..298 CDD:409353 4/4 (100%)
Ig strand G 306..309 CDD:409353 0/2 (0%)

Return to query results.
Submit another query.