DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr17 and NCAM1

DIOPT Version :9

Sequence 1:NP_001287297.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_001229536.1 Gene:NCAM1 / 4684 HGNCID:7656 Length:884 Species:Homo sapiens


Alignment Length:267 Identity:62/267 - (23%)
Similarity:104/267 - (38%) Gaps:55/267 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   405 RRNLTMPVLNITAQMGNHAYMPCQIHRLSDKPVSWVRMRDNHIISVDETTFIADERFQSIYQEDH 469
            |:|    ::|.||.:|....:.|......:..:||.  :|...|..:|.    ||::  |:.:|.
Human   217 RQN----IVNATANLGQSVTLVCDAEGFPEPTMSWT--KDGEQIEQEED----DEKY--IFSDDS 269

  Fly   470 DYTWSLQIKYVEPSDAGWYECQMATEPKL---SAKVHLQI-VKPKTELIGDQSRFVKAGSKVALH 530
            .   .|.||.|:.:|...|.|  ..|.|.   .|.:||:: .|||...:.:|:. ::...:|.|.
Human   270 S---QLTIKKVDKNDEAEYIC--IAENKAGEQDATIHLKVFAKPKITYVENQTA-MELEEQVTLT 328

  Fly   531 CIVRGTLDPPKYIIWFRGQKKISDSDERTGWYTQLDRNIF-----------------GTVGDNQN 578
            |...|  ||...|.|....:.|| |:|:..|.....:.:.                 |..|.::.
Human   329 CEASG--DPIPSITWRTSTRNIS-SEEKASWTRPEKQEVHAPWNWQVGRQKGQAGSAGFPGSHET 390

  Fly   579 -----------TIGSLIIPLVRKEDSGNYTCQPSNSVSVSVDLHVLSGEYSASAIMSTAARTTKG 632
                       .:.||.:..::..|:|.|.|..||::........|..:|:.......|..|.:|
Human   391 LDGHMVVRSHARVSSLTLKSIQYTDAGEYICTASNTIGQDSQSMYLEVQYAPKLQGPVAVYTWEG 455

  Fly   633 GR--STC 637
            .:  .||
Human   456 NQVNITC 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr17NP_001287297.1 IG_like 414..491 CDD:214653 20/76 (26%)
Ig 415..507 CDD:299845 25/95 (26%)
IG_like 521..612 CDD:214653 23/118 (19%)
IGc2 524..605 CDD:197706 23/108 (21%)
NCAM1NP_001229536.1 Ig1_NCAM-1 20..115 CDD:143273
IG 124..190 CDD:214652
Ig 211..307 CDD:325142 28/106 (26%)
Ig 306..438 CDD:325142 28/135 (21%)
Ig_3 447..519 CDD:316449 5/16 (31%)
FN3 534..631 CDD:238020
fn3 639..720 CDD:306538
Trypan_PARP <792..>864 CDD:330686
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.