DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr17 and negr1

DIOPT Version :9

Sequence 1:NP_001287297.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster
Sequence 2:XP_009300786.1 Gene:negr1 / 445374 ZFINID:ZDB-GENE-040822-27 Length:360 Species:Danio rerio


Alignment Length:238 Identity:60/238 - (25%)
Similarity:91/238 - (38%) Gaps:51/238 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   400 AGSAVRRNLTMPVLNITAQMGNHAYMPCQIHRLSDKPVSWVRMRDNHIISVDETTFIADERFQSI 464
            ||..|  :.|....::.::.|:.|.:.|.:.....|. :|  :..:.||......:..|.|...:
Zfish    34 AGQTV--DYTTSSESVVSRQGDTALLRCYLLDGISKG-AW--LNRSSIIYAGNDKWSGDPRVSIV 93

  Fly   465 YQEDHDYTWSLQIKYVEPSDAGWYECQMATEPKLSAKVHLQIVKPKTELIGDQSRF-VKAGSKVA 528
            ......:.:||||:.|:.:|.|.|.|.:.:|..|..|:...|||...::....|.. |..||.|:
Zfish    94 SNVGDKHEYSLQIQKVDVTDEGVYTCSIQSERNLHPKLIQLIVKVPPKIYDISSDITVNEGSNVS 158

  Fly   529 LHCIVRGTLDPPKYIIWFRGQKKISDSDERTGWYTQLDRNIFGTVGDNQNTIGSLIIPLVRKEDS 593
            |.|...|..:|           |||       |     |:               |.|..||.:|
Zfish   159 LICAASGKPEP-----------KIS-------W-----RH---------------ISPSARKYES 185

  Fly   594 GNYTCQPSNSVSVSVDLHVLSGEYSASAIMSTAARTTKGGRST 636
            |.|.    |...:|.|   .:|:|...|....|:..||..|.|
Zfish   186 GEYL----NITGISRD---QAGDYECGAENDIASPDTKTVRVT 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr17NP_001287297.1 IG_like 414..491 CDD:214653 17/76 (22%)
Ig 415..507 CDD:299845 21/91 (23%)
IG_like 521..612 CDD:214653 23/90 (26%)
IGc2 524..605 CDD:197706 20/80 (25%)
negr1XP_009300786.1 Ig 42..121 CDD:299845 18/81 (22%)
IG_like 44..136 CDD:214653 21/94 (22%)
I-set 140..222 CDD:254352 32/127 (25%)
IGc2 153..208 CDD:197706 25/99 (25%)
IG_like 236..312 CDD:214653
IGc2 238..304 CDD:197706
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.