DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr17 and Dscam3

DIOPT Version :9

Sequence 1:NP_001287297.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_996226.2 Gene:Dscam3 / 42103 FlyBaseID:FBgn0261046 Length:2087 Species:Drosophila melanogaster


Alignment Length:606 Identity:122/606 - (20%)
Similarity:199/606 - (32%) Gaps:170/606 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 SPL--ASWLRI-SFVLLVLPALGFGIQV---VTCSNPELGASAPDPVDLTWGGKNTEGQLTT--- 146
            :||  .|.||: :|:|...|.|.||...   |||:    ...:|.|: :||..:  :|.|.|   
  Fly    27 TPLLATSGLRVPTFLLEPAPRLLFGNDTGAQVTCT----AHGSPPPL-VTWVLR--DGSLATQVP 84

  Fly   147 -----ATRSTLPDSPMTTQ---NDLITTASNLATAKKPATAASEAV-------------VDTAET 190
                 :...||...|...|   .|:.........:.:..|..|..|             |:..|.
  Fly    85 GLRKISGNGTLHFPPFLAQYYRTDVHEATYRCRASNEAGTVLSRNVQVHAVVRRQFHVHVENTEV 149

  Fly   191 ------------AETAPPTEATSSWSSTAVARGMSSADGAGEAIATSQSAQIGLTTQATVRQTEA 243
                        .|...|....:||...........:|.||..:..:.|..:      .||...:
  Fly   150 YLGNSALIKCAIPEYVRPYVRVASWHRGEEILLPDLSDVAGRYVVLAASGDL------YVRSVRS 208

  Fly   244 QTASTATQAAAATSAATSAAIASAAAATETAAEMLISTIYPASTETDLHNSIERVEGQRGKMANA 308
            :. .....:...|:........|.|...:  .:.|...:.|.:|:    ..:..:..:||   |.
  Fly   209 ED-GLMKFSCLVTNTLNGERQRSDAVMLQ--VKELSKNLAPRTTQ----KPVMEIHVERG---ND 263

  Fly   309 FHPGVPDSLTKGFSIPTFLPPFPVF---------AAADLPAYRAA-----------ADAAEAAKL 353
            .|  :|.::...        |||:|         |...:|:.:..           ||..:|.|.
  Fly   264 VH--LPCNIQGN--------PFPIFTWYRVSDSAALYPIPSSQRVILSRTLLLIKNADERDAGKW 318

  Fly   354 AAEAAAQAAAAKTSSEAVTMSPEEQRRQMFNEQHSYLAAHRDGGDGAGSAVRRNLTMPVLNITAQ 418
            ..:|:.|..              |||.::....:||::.|               .:|.:.| ..
  Fly   319 ICQASNQFG--------------EQRIEIRLSVNSYVSVH---------------ILPQVQI-VN 353

  Fly   419 MGNHAYMPCQIHRLSDKPVSWVR----MRDNHIISV--DETTFIADERFQSIYQEDHDYTWSLQI 477
            .|..|...|.....:...:.|:.    ::.|:.::.  |...|::..              ||.:
  Fly   354 SGGTANFNCTTTGSAIDAIDWLHNGKPLQANNALTTGRDNIRFLSKS--------------SLLV 404

  Fly   478 KYVEPSDAGWYECQMATE-PKLSAKVHLQIVKPKTELIG---DQSRFVKAGSKVALHCIVRGTLD 538
            :.|...|.|.|:|.:..: ....|...|::.....|||.   :|:  |:.|..::|.|...|:  
  Fly   405 QNVGRRDRGVYQCLVENQRASAQAMAELKLGDTVPELIYTFIEQN--VRPGPLISLKCSASGS-- 465

  Fly   539 PPKYIIWFRGQKKISDSDER----TGWYTQLDRNIFGTVGDNQNTIGSLIIPLVRKEDSGNYTCQ 599
            ||....|....:.|.|....    .|.:..:.       ||   .|..|.|..||.:|.|.|.|.
  Fly   466 PPPQFAWLLDSQPIMDVSLHHRFAIGQFVDMS-------GD---VISHLNISHVRPDDGGLYKCV 520

  Fly   600 PSN---SVSVSVDLHVLSGEY 617
            .||   ||..|..|:|....|
  Fly   521 ASNSMGSVQHSARLNVYGPPY 541

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr17NP_001287297.1 IG_like 414..491 CDD:214653 14/82 (17%)
Ig 415..507 CDD:299845 17/98 (17%)
IG_like 521..612 CDD:214653 28/97 (29%)
IGc2 524..605 CDD:197706 24/87 (28%)
Dscam3NP_996226.2 IG 56..133 CDD:214652 18/83 (22%)
Ig 56..125 CDD:143165 15/75 (20%)
I-set 246..337 CDD:254352 22/121 (18%)
Ig 264..334 CDD:143165 17/93 (18%)
I-set 345..433 CDD:254352 17/102 (17%)
Ig 358..431 CDD:143165 14/86 (16%)
Ig 456..533 CDD:143165 25/88 (28%)
IGc2 553..619 CDD:197706
I-set 634..724 CDD:254352
ig 645..712 CDD:278476
IG_like 734..815 CDD:214653
Ig 745..815 CDD:299845
I-set 820..913 CDD:254352
Ig 838..920 CDD:299845
FN3 917..1033 CDD:238020
FN3 1040..1142 CDD:238020
fn3 1150..1237 CDD:278470
FN3 1263..1345 CDD:238020
Ig 1350..1436 CDD:299845
IG_like 1358..1436 CDD:214653
FN3 1441..1530 CDD:238020
FN3 1542..1620 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.