DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr17 and Ama

DIOPT Version :9

Sequence 1:NP_001287297.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster


Alignment Length:216 Identity:54/216 - (25%)
Similarity:87/216 - (40%) Gaps:46/216 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   408 LTMPVL-----NITAQMGNHAYMPCQIHRLSDKPVSWVRM-----RDNHIISVDETTFIADERFQ 462
            |:.||:     ::.|.:|:.....|.:..:....|||.:.     .::.::|:.....:.|:|:.
  Fly    30 LSAPVISQISKDVVASVGDSVEFNCTVEEVGQLSVSWAKRPSESDTNSVVLSMRNILSLPDQRYN 94

  Fly   463 SIYQEDHD-----YTWSLQIKYVEPSDAGWYECQM---ATEPKLSAKVHLQIVKPKTELIGD--- 516
            ....|...     ||:  :|:.:|.||.|.||||:   ||| |::.|:.|||..|  .:|.:   
  Fly    95 VTVTEGPKTGSAIYTF--RIQNIEVSDMGPYECQVLVSATE-KVTKKLSLQIKTP--PVIAENTP 154

  Fly   517 QSRFVKAGSKVALHCIVRGTLDPPKYIIWFRGQKKISDSDERTGWYTQLDRNIFGTVGDNQNTIG 581
            :|..|..|..:.|.|...|.  |...|.|.|                  :.|.....|.:.....
  Fly   155 KSTLVTEGQNLELTCHANGF--PKPTISWAR------------------EHNAVMPAGGHLLAEP 199

  Fly   582 SLIIPLVRKEDSGNYTCQPSN 602
            :|.|..|.:.|.|.|.|...|
  Fly   200 TLRIRSVHRMDRGGYYCIAQN 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr17NP_001287297.1 IG_like 414..491 CDD:214653 19/86 (22%)
Ig 415..507 CDD:299845 28/104 (27%)
IG_like 521..612 CDD:214653 19/82 (23%)
IGc2 524..605 CDD:197706 18/79 (23%)
AmaNP_731114.2 I-set 33..143 CDD:254352 29/112 (26%)
Ig 37..127 CDD:299845 20/91 (22%)
IG_like 154..234 CDD:214653 20/87 (23%)
IGc2 161..223 CDD:197706 18/80 (23%)
I-set 254..330 CDD:254352
IGc2 254..322 CDD:197706
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.