DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr17 and dpr11

DIOPT Version :9

Sequence 1:NP_001287297.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_001262320.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster


Alignment Length:452 Identity:161/452 - (35%)
Similarity:226/452 - (50%) Gaps:115/452 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 SWSSTAVARGMSSADGAGEAIATSQSAQI------GL--TTQATVRQTEAQTA-STATQAAAATS 257
            ||.:    |..|........:...|.||:      |:  .|.|:..||.|:.| ...:...|.||
  Fly     3 SWKN----RSRSEMQTLETRVRPLQGAQLTQLLLGGILCLTIASHTQTSAEAAGGRVSGPGAGTS 63

  Fly   258 AATSAAIASAAAATETAAEMLISTIYPASTETDLHNSIERVEGQRGKMANAFHPGVPDSLTKGFS 322
            .....:.||||:...::.|                                  .|.|.|.|    
  Fly    64 EGAGTSSASAASTAISSDE----------------------------------SGDPSSAT---- 90

  Fly   323 IPTFLPPFPVFAAADLPAYRAAADAAEAAKLAAEAAAQAAAAKTSSEAVTMSPEEQRRQMFNEQH 387
                                |.:..|:.:.|..||:|.:|   ||.   .:.|            
  Fly    91 --------------------AFSSLAQVSSLLPEASALSA---TSG---LVEP------------ 117

  Fly   388 SYLAAHRDGGDGAGSAVRRNLTMPVLNITAQMGNHAYMPCQIHRLSDKPVSWVRMRDNHIISVDE 452
             ||       ||..::          |:|.|:|.|||:||::.:|.:|.|||:|:||.||::||.
  Fly   118 -YL-------DGYATS----------NVTTQIGTHAYLPCRVKQLGNKSVSWIRLRDGHILTVDR 164

  Fly   453 TTFIADERFQSIYQEDHDYTWSLQIKYVEPSDAGWYECQMATEPKLSAKVHLQIVKPKTELIGDQ 517
            ..||||:||.:|.|.|.  .|:||||||:..|||.||||::||||:||:|.||:|.|:||::|:.
  Fly   165 AVFIADQRFLAIKQPDK--YWTLQIKYVQARDAGSYECQVSTEPKVSARVQLQVVVPRTEILGEP 227

  Fly   518 SRFVKAGSKVALHCIVRGTLDPPKYIIWFRGQKKISDSDERTGWYTQLDRNIFGTVGDNQNTIGS 582
            .|:|||||.|.|.|||||.|:||.:|:|:.|.::::....|  ..||||.|:....|:.|:||||
  Fly   228 DRYVKAGSNVVLRCIVRGALEPPTFIMWYHGAEQLAADSRR--HRTQLDPNLPEASGEGQSTIGS 290

  Fly   583 LIIPLVRKEDSGNYTCQPSNSVSVSVDLHVLSGEYSASAIMSTAARTTKGGRSTCHSTLGLL 644
            |||...:|.|:|||||.||||.|.:|.|::::||.||||:.|:||.|    |:...|.|.||
  Fly   291 LIIESAKKRDTGNYTCSPSNSPSATVTLNIINGESSASAVTSSAATT----RAYALSILALL 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr17NP_001287297.1 IG_like 414..491 CDD:214653 42/76 (55%)
Ig 415..507 CDD:299845 52/91 (57%)
IG_like 521..612 CDD:214653 47/90 (52%)
IGc2 524..605 CDD:197706 41/80 (51%)
dpr11NP_001262320.1 I-set 125..216 CDD:254352 52/102 (51%)
Ig 127..217 CDD:299845 52/91 (57%)
IG_like 227..320 CDD:214653 48/94 (51%)
IGc2 234..311 CDD:197706 39/78 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449719
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1457433at2759
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.