DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr17 and kirrel1a

DIOPT Version :9

Sequence 1:NP_001287297.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_001349348.1 Gene:kirrel1a / 405804 ZFINID:ZDB-GENE-040426-2126 Length:819 Species:Danio rerio


Alignment Length:245 Identity:55/245 - (22%)
Similarity:88/245 - (35%) Gaps:74/245 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   438 SWVRMRDNHIISVDETTFIADERFQSIYQEDHDYTWSLQIKYVEPSDAGWYECQMATEPKL-SAK 501
            :|.|.|...::.|.:                    ::|:|...|.||...|||| |||..| |.:
Zfish    67 AWPRYRVLRLVDVGQ--------------------YNLEISAAELSDDSLYECQ-ATEAALRSRR 110

  Fly   502 VHLQIVKPKTELI--GDQSRFVKAGSKVALHCIVRGTLDPPKYIIWFRGQKKISDSDERTGWYTQ 564
            ..|.::.|..|.:  |.....:.||....:.|:.||. .|...|.|.:....|..:...|     
Zfish   111 AKLTV
LIPPDEPVIEGSPEILLTAGVPYNMSCVSRGA-KPASVIEWQKDGLPIEGAVSTT----- 169

  Fly   565 LDRNIFGTVGDNQNTIGSLIIPLVRKE-DSG-NYTCQPSN-------SVSVSVDLH--------- 611
                  ..:.|.:.......:|:...: |:| |:||..:|       ..::::::|         
Zfish   170 ------EVLPDRKRVTTRSYLPIQPLDTDTGKNFTCVATNLAVPMGKRATITLNVHHPPVVTLSI 228

  Fly   612 ----VLSGEYSASAIMSTAARTTKGGRSTCHSTLGLLGILGLLWAMQGAM 657
                ||.||           |.|    .||.:|.. ..|:|..||..|.:
Zfish   229 EPRSVLEGE-----------RVT----FTCQATAN-PPIMGYKWAKGGVV 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr17NP_001287297.1 IG_like 414..491 CDD:214653 11/52 (21%)
Ig 415..507 CDD:299845 19/69 (28%)
IG_like 521..612 CDD:214653 19/112 (17%)
IGc2 524..605 CDD:197706 17/89 (19%)
kirrel1aNP_001349348.1 I-set 21..115 CDD:333254 19/68 (28%)
Ig2_KIRREL3-like 137..218 CDD:143236 16/92 (17%)
I-set 222..303 CDD:333254 14/57 (25%)
Ig_3 307..372 CDD:316449
Ig5_KIRREL3 390..493 CDD:143306
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.