DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr17 and dpr10

DIOPT Version :9

Sequence 1:NP_001287297.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster


Alignment Length:283 Identity:88/283 - (31%)
Similarity:136/283 - (48%) Gaps:63/283 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   407 NLTMPVLNITAQMGNHAYMPCQIHRLSDKPVSWVRMRDNHIISVDETTFIADERFQSIYQEDHDY 471
            :|||| .|||:.:|..||:.|::..|.:|.|:|:|.||.||::|...|:..|:|||:.|..|.| 
  Fly    56 DLTMP-RNITSLVGKSAYLGCRVKHLGNKTVAWIRHRDLHILTVGTYTYTTDQRFQTSYHRDID- 118

  Fly   472 TWSLQIKYVEPSDAGWYECQMATEPKLSAKVHLQIVK---------------------------- 508
            .|:||||:.:..|||.||||::|:|..|..|:|.||.                            
  Fly   119 EWTLQIKWAQQRDAGVYECQISTQPVRSYSVNLNIVDLIDAETSDIMQQYYNDDAFYIAENRVYQ 183

  Fly   509 ------------------PKTELIGDQSRFVKAGSKVALHCIVRGTLDPPKYIIWFRGQKKISDS 555
                              |...::|....:|..||.:.|.||::.:.:||.:|.|:...|.:  |
  Fly   184 SSNDEFAGMFGPIQTVAVPTATILGGPDLYVDKGSTINLTCIIKFSPEPPTHIFWYHQDKVL--S 246

  Fly   556 DERTGWYTQLDRNIFGTVGDNQNTIGSLIIPLVRKEDSGNYTCQPSNSVSVSVDLHVLSGE---- 616
            :|.:|     .|..|.|: .::.|...|:|.......||.|:|.|||:...|:.:|||.||    
  Fly   247 EETSG-----GRLKFKTI-KSEETKSILLIYDADLLHSGKYSCYPSNTEIASIRVHVLQGERPEA 305

  Fly   617 ---YSASAIMSTAARTTKGGRST 636
               .:|.|.::.|..:...|::|
  Fly   306 MQTNAAPAAVALACWSCHFGQAT 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr17NP_001287297.1 IG_like 414..491 CDD:214653 35/76 (46%)
Ig 415..507 CDD:299845 41/91 (45%)
IG_like 521..612 CDD:214653 28/90 (31%)
IGc2 524..605 CDD:197706 26/80 (33%)
dpr10NP_729591.1 Ig 63..143 CDD:299845 37/80 (46%)
IG_like 210..297 CDD:214653 28/94 (30%)
IGc2 217..287 CDD:197706 24/77 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444666
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.