DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr17 and dpr13

DIOPT Version :9

Sequence 1:NP_001287297.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster


Alignment Length:416 Identity:115/416 - (27%)
Similarity:181/416 - (43%) Gaps:82/416 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   254 AATSAATSAAIASAAAATETAAEMLISTIYPASTETDLH---NSI--ERVEGQRGKMANAFHPGV 313
            ||.......|.||.......||.|..    |||..:..|   |.|  :..||:            
  Fly    33 AACGICDHTASASPGGGKTVAATMTT----PASEPSVRHINQNLIMSQSKEGE------------ 81

  Fly   314 PDSLTKGFSIPTFLPPFPVFAAADLPAYRAAADAAEAAKLAAEAA----AQAAAAKTS-SEAVTM 373
                           |.||    ..|..::||.|..::..:.::.    .|:....|. .|||..
  Fly    82 ---------------PVPV----PQPYAQSAASAGGSSITSFDSTNVIDGQSQPTPTHLQEAVLQ 127

  Fly   374 SPEEQRRQMFNEQHSY-LAAHR-----------DGGDGAGSAV--------RRNLTMPVLNITAQ 418
            :....|.|..:....| :..||           :|.:|...::        ..|.|:    :|.|
  Fly   128 THSHSRIQAKDTAGPYPIPVHRPEPVENHLEANNGIEGGMESLFGTPMYFGTENSTV----VTTQ 188

  Fly   419 MGNHAYMPCQIHRLSDKPVSWVRMRDNHIISVDETTFIADERFQSIYQEDHDYTWSLQIKYVEPS 483
            :|..|::||.:|.:.:..|||:|.:|.|:::|..||:.:||||.:.:.: |...|:||||:|:..
  Fly   189 IGATAHVPCTVHHIGEGVVSWIRKKDYHLLTVGLTTYSSDERFSATHLK-HSEDWTLQIKFVQLR 252

  Fly   484 DAGWYECQMATEPKLSAKVHLQIVKPKTELIGDQSRFVKAGSKVALHCIVRGTLDPPKYIIWFRG 548
            |||.||||::|.|..|..:||.:|:.:.|:.|...|::..||.:.|.|.|....:..:||.|:..
  Fly   253 DAGVYECQVSTHPPTSIFLHLSVVEARAEITGPPIRYLTPGSTLRLQCRVVQNTEASEYIFWYHD 317

  Fly   549 QKKISDSDERTGWYTQLDRNI-FGTVGDNQNTIGSLIIPLVRKEDSGNYTCQPSNSVSVSVDLHV 612
            .:.|:         ..:||.| ..|..|.|::  .|.|...|:|.|||:||..||:...||.:|:
  Fly   318 NRMIN---------YDIDRGINVSTEPDFQSS--ELTIQRTRREHSGNFTCVASNTQPASVLVHI 371

  Fly   613 LSGEYSASAIMSTAARTTKGGRSTCH 638
            ..|:..|:........:||..:|..|
  Fly   372 FKGDNPAAMYHGHVGGSTKTTQSQLH 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr17NP_001287297.1 IG_like 414..491 CDD:214653 32/76 (42%)
Ig 415..507 CDD:299845 39/91 (43%)
IG_like 521..612 CDD:214653 28/91 (31%)
IGc2 524..605 CDD:197706 26/81 (32%)
dpr13NP_001033956.2 V-set 180..276 CDD:284989 41/100 (41%)
IG_like 182..262 CDD:214653 35/84 (42%)
IG_like 285..362 CDD:214653 26/87 (30%)
IGc2 292..361 CDD:197706 24/79 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.