DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr17 and babos

DIOPT Version :9

Sequence 1:NP_001287297.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_001286719.1 Gene:babos / 37557 FlyBaseID:FBgn0034724 Length:196 Species:Drosophila melanogaster


Alignment Length:212 Identity:48/212 - (22%)
Similarity:80/212 - (37%) Gaps:51/212 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   447 IISVDETTFIADERFQSIYQEDHDYTWSLQIKYVEPSDAGWYECQMATEPKLSA--KVHLQIVKP 509
            :||..::: :.|::.|:  .:|.||             .|  |.|.|..|:..:  .|..:.:..
  Fly    21 VISYPQSS-MDDDQMQA--DDDFDY-------------GG--EDQSAPSPQTKSPNPVASEKINK 67

  Fly   510 KTELIGDQSRFVKAGSKVALHCIVRGTLDPPKYII-WFRGQKKISDSDERTGWYTQLDRNIFGTV 573
            ...:.|.:      |..|.|.|.|...|.....:: |:.|...||:.........:||.|.    
  Fly    68 TLSVTGIR------GEDVVLKCDVGSNLHSSDVVVLWYFGDNVISNGKNLVQPNFKLDANY---- 122

  Fly   574 GDNQNTIGSLIIPLVRKEDSGNYTCQ--PSNSVSVSVDLHVLSGEYSASAIMSTAARTTKGGRST 636
                    .|.|.....:.:|:|.|:  ||.||   |:..|...|:|..||...::.:..|..|:
  Fly   123 --------DLTILKASPQVAGSYLCKVLPSGSV---VNTKVTIAEHSLDAIAPESSTSAAGSASS 176

  Fly   637 -------CHSTLGLLGI 646
                   ..:.|.|||:
  Fly   177 FLGCTVLASTVLLLLGM 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr17NP_001287297.1 IG_like 414..491 CDD:214653 9/43 (21%)
Ig 415..507 CDD:299845 13/61 (21%)
IG_like 521..612 CDD:214653 23/93 (25%)
IGc2 524..605 CDD:197706 21/83 (25%)
babosNP_001286719.1 ig 70..154 CDD:278476 25/104 (24%)
IG_like 70..154 CDD:214653 25/104 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.