DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr17 and Cadm4

DIOPT Version :10

Sequence 1:NP_731670.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_001040572.1 Gene:Cadm4 / 365216 RGDID:1304722 Length:388 Species:Rattus norvegicus


Alignment Length:262 Identity:59/262 - (22%)
Similarity:104/262 - (39%) Gaps:51/262 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   397 GDGAGSAVRRNLTMPVLNITAQMGNHAYMPCQIHRLSDKPVSWVRMRDNHIISVDETTFIADERF 461
            |.|....|:..      |:|...|..|.:.|::|:. |..:..::......:..:.|..:.||||
  Rat    20 GPGTAQEVQTE------NVTVAEGGVAEITCRLHQY-DGSIVVIQNPARQTLFFNGTRALKDERF 77

  Fly   462 QSIYQEDHDYTWSLQIKYVEPSDAGWYECQMATEPKLSAKVHLQI------VKPKTELIGDQSRF 520
            |  .:|.......:::......|.|.|.||:.||     ..|.||      |.|:..::..:.:.
  Rat    78 Q--LEEFSPRRVRIRLSDARLEDEGGYFCQLYTE-----DTHHQIATLTVLVAPENPVVEVREQA 135

  Fly   521 VKAGSKVALHCIVRGTLDPPKYIIWFRGQKKIS--DSDERTG--WYTQLDRNIFGTVGDNQNTIG 581
            |: |.:|.|.|:|..: .|...:.|:|.:|::.  .|.:..|  |                 ::.
  Rat   136 VE-GGEVELSCLVPRS-RPAAVLRWYRDRKELKGVSSGQENGKVW-----------------SVA 181

  Fly   582 SLI-IPLVRKEDSGNYTCQPSNSVSVS----VDLHVLSGEYSASAIMSTAARTTKGGRS---TCH 638
            |.: ..:.||:|.|...|:..|....|    ...:||..:||.:|.:..:....:.|.:   ||.
  Rat   182 STVRFRVDRKDDGGIVICEAQNQALPSGHSKQTQYVLDVQYSPTARIHASQAVVREGDTLVLTCA 246

  Fly   639 ST 640
            .|
  Rat   247 VT 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr17NP_731670.1 V-set 415..507 CDD:462230 23/97 (24%)
IG_like 521..612 CDD:214653 21/99 (21%)
Ig strand B 527..531 CDD:409353 2/3 (67%)
Ig strand C 542..546 CDD:409353 0/3 (0%)
Ig strand E 581..585 CDD:409353 1/4 (25%)
Ig strand F 595..600 CDD:409353 1/4 (25%)
Cadm4NP_001040572.1 Ig 29..120 CDD:472250 24/104 (23%)
Ig strand B 40..44 CDD:409465 1/3 (33%)
Ig strand C 53..57 CDD:409465 0/3 (0%)
Ig strand E 87..91 CDD:409465 0/3 (0%)
Ig strand F 101..106 CDD:409465 2/4 (50%)
Ig strand G 113..116 CDD:409465 1/2 (50%)
IgI_2_Necl-4 121..220 CDD:409468 25/117 (21%)
Ig strand A 121..124 CDD:409468 1/2 (50%)
Ig strand A' 127..131 CDD:409468 0/3 (0%)
Ig strand B 139..149 CDD:409468 4/9 (44%)
Ig strand C 152..161 CDD:409468 2/8 (25%)
Ig strand C' 162..165 CDD:409468 1/2 (50%)
Ig strand D 167..174 CDD:409468 1/6 (17%)
Ig strand E 177..187 CDD:409468 2/26 (8%)
Ig strand F 195..203 CDD:409468 2/7 (29%)
Ig strand G 212..219 CDD:409468 1/6 (17%)
Ig_3 224..295 CDD:464046 5/25 (20%)
4.1m 344..362 CDD:128590
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.