DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr17 and Dscam1

DIOPT Version :9

Sequence 1:NP_001287297.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_001246162.1 Gene:Dscam1 / 35652 FlyBaseID:FBgn0033159 Length:2038 Species:Drosophila melanogaster


Alignment Length:421 Identity:99/421 - (23%)
Similarity:155/421 - (36%) Gaps:113/421 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   303 GKMANAFHPGVPDSLTKGFSIPTFLP------PFPVFAAADLPAYRAAADAAEAAKLAAEAAAQA 361
            |....|.:|  ||:..||   |.||.      .|.....|::....:.....|...:.::..|..
  Fly    23 GSQTLAANP--PDADQKG---PVFLKEPTNRIDFSNSTGAEIECKASGNPMPEIIWIRSDGTAVG 82

  Fly   362 ---AAAKTSSEAVTMSP----EEQRRQMFNEQHSYLAAHRDGGDGAGSAVRRNLTMPVLNITAQM 419
               ...:.||:...:.|    |:.|:::..:.::.||.::     .||.:.|:     :::.|.:
  Fly    83 DVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYACLARNQ-----FGSIISRD-----VHVRAVV 137

  Fly   420 GNHAYMPCQIHRLSDKPVSWVRMRDNHIISVDETTFIAD------------ERFQSIYQEDHDY- 471
            ..| |.. .||:      ::|...::.|:..|..:|:||            |.|....:.|..| 
  Fly   138 SQH-YEE-DIHK------AFVIRGNSAILKCDIPSFVADFVNVISWHSDEKENFYPGTEYDGKYL 194

  Fly   472 ---TWSLQIKYVEPSDAGWYECQMATEPKLSAKVHLQIVKPK---TELIGDQS------------ 518
               :..|.|:.|.|.| |:...|..|:.:|:.:..|...|.:   ||.:|..|            
  Fly   195 VLPSGELHIREVGPED-GYKSYQCRTKHRLTGETRLSATKGRLVITEPVGSVSPQLSGNGNQEHI 258

  Fly   519 ---RFVKAGSKVALHCIVRGTLDPPKYIIWFRGQKKISDSDERTGWYTQLDRNIFGT-------V 573
               |..|.|| |.|.|..:....|     :||             ||    :.|.||       :
  Fly   259 TLTRVPKMGS-VTLMCPAQAYPVP-----FFR-------------WY----KFIEGTTRKQAVVL 300

  Fly   574 GDNQNTI-GSLIIPLVRKEDSGNYTCQPSNSVSVSVDLHVLSGEYSASAIMSTAARTTKGGRS-- 635
            .|....: |:|||.....||||.|.|..:|||.......||:.....||.:....:|...||.  
  Fly   301 NDRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDFGRPAV 365

  Fly   636 -TCHSTLGLLG--ILGLLWAMQGAM--HTPP 661
             ||..|    |  |..:.|...|..  |:.|
  Fly   366 FTCQYT----GNPIKTVSWMKDGKAIGHSEP 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr17NP_001287297.1 IG_like 414..491 CDD:214653 21/92 (23%)
Ig 415..507 CDD:299845 25/107 (23%)
IG_like 521..612 CDD:214653 28/98 (29%)
IGc2 524..605 CDD:197706 26/88 (30%)
Dscam1NP_001246162.1 Ig 38..130 CDD:299845 17/99 (17%)
IG 57..133 CDD:214652 13/85 (15%)
IG_like 267..343 CDD:214653 29/98 (30%)
Ig 269..340 CDD:143165 25/92 (27%)
IG_like 353..425 CDD:214653 12/44 (27%)
IGc2 361..413 CDD:197706 11/36 (31%)
I-set 433..527 CDD:254352
IGc2 446..517 CDD:197706
I-set 533..618 CDD:254352
IGc2 544..607 CDD:197706
Ig 641..714 CDD:143165
IGc2 735..804 CDD:197706
I-set 819..914 CDD:254352
Ig 833..921 CDD:299845
FN3 918..1011 CDD:238020
FN3 1018..1116 CDD:238020
FN3 1124..1217 CDD:238020
FN3 1222..1312 CDD:238020
Ig 1339..1406 CDD:299845
FN3 1409..1499 CDD:238020
FN3 1504..1584 CDD:238020
Dscam_C 1890..2008 CDD:289151
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.