DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr17 and dpr19

DIOPT Version :9

Sequence 1:NP_001287297.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_001260336.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster


Alignment Length:290 Identity:75/290 - (25%)
Similarity:123/290 - (42%) Gaps:58/290 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   415 ITAQMGNHAYMPCQIHRLSDKPVSWVRMRDNHIISVDETTFIADERFQSIYQEDHDYTWSLQIKY 479
            :.||.|..|.:||.:...|...|||:|.:|..:::|..:|..:|:|| .:....|...|||:||.
  Fly    50 VIAQKGGLAILPCVVKVNSPATVSWIRRKDFQLLTVGLSTHSSDKRF-LVEHTRHMGHWSLRIKA 113

  Fly   480 VEPSDAGWYECQMATEPKLSAKVHLQIVKPKTELIGDQSRFVKAGSKVALHCIVRGTLDPPKYII 544
            |...|.|:||||::..|..|..:.|:||:...|:.......:...|.:.|.|.::...:.|.::.
  Fly   114 VREEDRGFYECQLSIYPTQSIVIELKIVEAVAEISSAPELHIDETSTLRLECKLKRATENPAFVF 178

  Fly   545 WFRGQK-------------KISDSDERTG-WYTQLDRN-------IFGTVGDNQNTIGS------ 582
            |:...|             .|..|:.::| :|.....|       :..:.|...:.:||      
  Fly   179 WYHDSKMINYDSQGGFVVTSIGQSNPQSGQFYRSSPANKSRATMPMESSNGVLNSLLGSSDAIKA 243

  Fly   583 ----------------------------LIIPLVRKEDSGNYTCQPSNSVSVSVDLHVLSGEYSA 619
                                        |.:..|....:|||||.|||:...|:.:|||.||.:|
  Fly   244 PAANVPSSTPYMTQQHQSAYLLNPSVSVLTVKQVNFRHAGNYTCAPSNARPASITVHVLRGEKTA 308

  Fly   620 SAIMSTAARTTKGGRSTCHSTLGLLGILGL 649
            :  |..|.|:.....:..:.|.||:.:.||
  Fly   309 A--MQHANRSILDTETNGNGTFGLITLGGL 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr17NP_001287297.1 IG_like 414..491 CDD:214653 28/75 (37%)
Ig 415..507 CDD:299845 33/91 (36%)
IG_like 521..612 CDD:214653 25/145 (17%)
IGc2 524..605 CDD:197706 24/135 (18%)
dpr19NP_001260336.1 IG_like 50..127 CDD:214653 30/77 (39%)
IGc2 55..125 CDD:197706 26/70 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.