DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr17 and DIP-theta

DIOPT Version :9

Sequence 1:NP_001287297.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster


Alignment Length:313 Identity:68/313 - (21%)
Similarity:118/313 - (37%) Gaps:77/313 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   343 AAADAAEAAKLAAEAAAQAAAAKTSSEAVTMSPEEQ---RRQMF----NEQHSYLAAH---RDGG 397
            |.|.||..:.:....|....||:.|.:...:...:|   :.|.|    :|:|.::|.|   ....
  Fly    44 ATATAAVVSIICLSLALPGCAAQESDDEGELHHLDQMHHQHQDFIIGESEEHDHIAHHLAEMQNK 108

  Fly   398 DGAGSAVRRNLTMPVL-------------NITAQMGNHAYMPCQIHRLSDKPVSWVRMRDNHIIS 449
            |.....:|.:..:..:             |:|..:...|.:.|.:..|....::|:|:....|::
  Fly   109 DELLEDIREDTVVNAIPEKDLPKFGELLQNVTVPVSREAVLQCVVDNLQTYKIAWLRVDTQTILT 173

  Fly   450 VDETTFIADERFQSIYQEDHDYTWSLQIKYVEPSDAGWYECQMATEPKLSAKVHLQIVKP----- 509
            :.......:.|....:.|..  .|.|:|:.|:.||.|||.||:.|:|..|...:|.:|.|     
  Fly   174 IQNHVITKNHRMSITHAEKR--AWILRIRDVKESDKGWYMCQINTDPMKSQVGYLDVVVPPDILD 236

  Fly   510 ---KTELIGDQSRFVKAGSKVALHCIVRGTLDPPKYIIWFR----------GQKKISDSDERTGW 561
               .|:::      ::.||.|.|.|...|:  |...|.|.|          |.:.::.:      
  Fly   237 YPTSTDMV------IREGSNVTLKCAATGS--PTPTITWRREGGELIPLPNGAEAVAYN------ 287

  Fly   562 YTQLDRNIFGTVGDNQNTIGS-LIIPLVRKEDSGNYTCQPSNSVSVSVDLHVL 613
                               || |.|..|.:.:.|.|.|..||.:..:|...|:
  Fly   288 -------------------GSFLTIAKVNRLNMGAYLCIASNGIPPTVSKRVM 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr17NP_001287297.1 IG_like 414..491 CDD:214653 19/76 (25%)
Ig 415..507 CDD:299845 24/91 (26%)
IG_like 521..612 CDD:214653 22/101 (22%)
IGc2 524..605 CDD:197706 21/91 (23%)
DIP-thetaNP_723103.1 Ig 137..230 CDD:299845 25/94 (27%)
IG_like 137..230 CDD:214653 25/94 (27%)
IG_like 240..324 CDD:214653 24/115 (21%)
IGc2 247..310 CDD:197706 19/89 (21%)
Ig 327..419 CDD:299845
IG_like 343..420 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I12107
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.