DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr17 and DIP-eta

DIOPT Version :10

Sequence 1:NP_731670.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_608946.3 Gene:DIP-eta / 33793 FlyBaseID:FBgn0031725 Length:450 Species:Drosophila melanogaster


Alignment Length:220 Identity:62/220 - (28%)
Similarity:99/220 - (45%) Gaps:52/220 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   411 PVLNITAQMGNHAYMPCQIHRLSDKPVSWVRMRDNHIISVDETTFIADERFQSIYQEDHDYTWSL 475
            |::|:||.:|..|::.|.:..|....|:|:|:....|:::.......::|. .|...:|. ||::
  Fly    48 PIVNMTAPVGRDAFLTCVVQDLGPYKVAWLRVDTQTILTIQNHVITKNQRI-GIANSEHK-TWTM 110

  Fly   476 QIKYVEPSDAGWYECQMATEPKLSAKVHLQIVKP--------KTELIGDQSRFVKAGSKVALHCI 532
            :||.::.||.|||.||:.|:|..|...:|.:|.|        .|:::      |:.||.|.|.|.
  Fly   111 RIKDIKESDKGWYMCQINTDPMKSQMGYLDVVVPPDILDYPTSTDMV------VREGSNVTLKCA 169

  Fly   533 VRGTLDPPKYIIWFR----------GQKKISDSDERTGWYTQLDRNIFGTVGDNQNTIGSLIIPL 587
            ..|:.:|.  |.|.|          |::.:|               |.||         .|:||.
  Fly   170 ATGSPEPT--ITWRRESGVPIELATGEEVMS---------------IEGT---------DLVIPN 208

  Fly   588 VRKEDSGNYTCQPSNSVSVSVDLHV 612
            ||:...|.|.|..||.|..||...:
  Fly   209 VRRHHMGAYLCIASNGVPPSVSKRI 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr17NP_731670.1 V-set 415..507 CDD:462230 28/91 (31%)
IG_like 521..612 CDD:214653 29/100 (29%)
Ig strand B 527..531 CDD:409353 2/3 (67%)
Ig strand C 542..546 CDD:409353 1/3 (33%)
Ig strand E 581..585 CDD:409353 1/3 (33%)
Ig strand F 595..600 CDD:409353 2/4 (50%)
DIP-etaNP_608946.3 IG_like 51..137 CDD:214653 28/87 (32%)
Ig strand B 60..64 CDD:409353 1/3 (33%)
Ig strand C 73..77 CDD:409353 1/3 (33%)
Ig strand E 108..112 CDD:409353 1/3 (33%)
Ig strand F 122..127 CDD:409353 3/4 (75%)
Ig strand G 134..137 CDD:409353 1/2 (50%)
IgI_1_MuSK 145..237 CDD:409562 30/121 (25%)
Ig strand A 145..148 CDD:409562 0/2 (0%)
Ig strand A' 153..158 CDD:409562 1/10 (10%)
Ig strand B 164..171 CDD:409562 3/6 (50%)
Ig strand C 177..182 CDD:409562 2/6 (33%)
Ig strand C' 184..186 CDD:409562 0/1 (0%)
Ig strand D 194..197 CDD:409562 0/2 (0%)
Ig strand E 202..208 CDD:409562 3/14 (21%)
Ig strand F 215..222 CDD:409562 3/6 (50%)
Ig strand G 229..237 CDD:409562 1/5 (20%)
IG_like 252..335 CDD:214653
Ig strand B 258..262 CDD:409353
Ig strand C 271..282 CDD:409353
Ig strand E 301..306 CDD:409353
Ig strand F 316..321 CDD:409353
Ig strand G 329..332 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.