DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr17 and dpr2

DIOPT Version :9

Sequence 1:NP_001287297.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster


Alignment Length:239 Identity:82/239 - (34%)
Similarity:125/239 - (52%) Gaps:26/239 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   414 NITAQMGNHAYMPCQIHRLSDKPVSWVRMRDNHIISVDETTFIADERFQSIYQEDHDYTWSLQIK 478
            |||.:.|:.|.:.|::..|.||.|||:|.||.||::....|:.:||||:.:...| ...|:|.:|
  Fly   115 NITTRTGHTAAINCRVDNLGDKSVSWIRKRDLHILTAGILTYTSDERFKVVRTAD-SKDWTLHVK 178

  Fly   479 YVEPSDAGWYECQMATEPKLSAKVHLQ-IVKP---KTELIGDQSRFVKAGSKVALHCIVR----- 534
            |.:|.|:|.||||:.||||:|....|. ||.|   |..:.|....:||.||.|.|.|.|:     
  Fly   179 YAQPRDSGIYECQVNTEPKISMAFRLNVIVTPPDAKAIIAGPTDLYVKVGSSVTLTCHVKQPATS 243

  Fly   535 -GTLDPPKYIIWFRGQKKIS-----DSDERTGWYTQLDR-NIFGTVGDNQNTIGSLIIPLVRKED 592
             ..:.|   |.|:||...::     .:|..    ..|.| ::..|:.:...:  .|.|...:..|
  Fly   244 AQDIGP---IYWYRGPYILTPFVAHPNDAA----IDLQRISMESTLAEKLQS--RLRIANAQLLD 299

  Fly   593 SGNYTCQPSNSVSVSVDLHVLSGEYSASAIMSTAARTTKGGRST 636
            :|||||.|:.:.:.||.::|::.|..|:...|.|.||:...||:
  Fly   300 TGNYTCMPTTAEAASVVVNVINDESPAAMQKSRAIRTSGSMRSS 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr17NP_001287297.1 IG_like 414..491 CDD:214653 32/76 (42%)
Ig 415..507 CDD:299845 39/92 (42%)
IG_like 521..612 CDD:214653 28/102 (27%)
IGc2 524..605 CDD:197706 24/92 (26%)
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 40/91 (44%)
Ig 116..192 CDD:299845 32/76 (42%)
ig 220..306 CDD:278476 24/94 (26%)
IG_like 220..306 CDD:214653 24/94 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444687
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D104656at50557
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.