DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr17 and dpr2

DIOPT Version :10

Sequence 1:NP_731670.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster


Alignment Length:239 Identity:82/239 - (34%)
Similarity:125/239 - (52%) Gaps:26/239 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   414 NITAQMGNHAYMPCQIHRLSDKPVSWVRMRDNHIISVDETTFIADERFQSIYQEDHDYTWSLQIK 478
            |||.:.|:.|.:.|::..|.||.|||:|.||.||::....|:.:||||:.:...| ...|:|.:|
  Fly   115 NITTRTGHTAAINCRVDNLGDKSVSWIRKRDLHILTAGILTYTSDERFKVVRTAD-SKDWTLHVK 178

  Fly   479 YVEPSDAGWYECQMATEPKLSAKVHLQ-IVKP---KTELIGDQSRFVKAGSKVALHCIVR----- 534
            |.:|.|:|.||||:.||||:|....|. ||.|   |..:.|....:||.||.|.|.|.|:     
  Fly   179 YAQPRDSGIYECQVNTEPKISMAFRLNVIVTPPDAKAIIAGPTDLYVKVGSSVTLTCHVKQPATS 243

  Fly   535 -GTLDPPKYIIWFRGQKKIS-----DSDERTGWYTQLDR-NIFGTVGDNQNTIGSLIIPLVRKED 592
             ..:.|   |.|:||...::     .:|..    ..|.| ::..|:.:...:  .|.|...:..|
  Fly   244 AQDIGP---IYWYRGPYILTPFVAHPNDAA----IDLQRISMESTLAEKLQS--RLRIANAQLLD 299

  Fly   593 SGNYTCQPSNSVSVSVDLHVLSGEYSASAIMSTAARTTKGGRST 636
            :|||||.|:.:.:.||.::|::.|..|:...|.|.||:...||:
  Fly   300 TGNYTCMPTTAEAASVVVNVINDESPAAMQKSRAIRTSGSMRSS 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr17NP_731670.1 V-set 415..507 CDD:462230 39/92 (42%)
IG_like 521..612 CDD:214653 28/102 (27%)
Ig strand B 527..531 CDD:409353 2/3 (67%)
Ig strand C 542..546 CDD:409353 1/3 (33%)
Ig strand E 581..585 CDD:409353 1/3 (33%)
Ig strand F 595..600 CDD:409353 4/4 (100%)
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 40/91 (44%)
Ig strand A' 116..118 CDD:409355 1/1 (100%)
Ig strand B 122..130 CDD:409355 2/7 (29%)
CDR1 130..136 CDD:409355 1/5 (20%)
FR2 137..151 CDD:409355 8/13 (62%)
Ig strand C 137..143 CDD:409355 3/5 (60%)
Ig strand C' 149..153 CDD:409355 0/3 (0%)
CDR2 153..162 CDD:409355 3/8 (38%)
Ig strand D 162..167 CDD:409355 1/4 (25%)
FR3 163..192 CDD:409355 11/29 (38%)
Ig strand E 172..178 CDD:409355 2/5 (40%)
Ig strand F 186..192 CDD:409355 4/5 (80%)
IG_like 220..306 CDD:214653 24/94 (26%)
Ig strand B 231..235 CDD:409353 2/3 (67%)
Ig strand C 261..265 CDD:409353 0/3 (0%)
Ig strand E 289..292 CDD:409353 1/2 (50%)
Ig strand F 302..307 CDD:409353 4/4 (100%)
Ig strand G 310..313 CDD:409353 0/2 (0%)

Return to query results.
Submit another query.