Sequence 1: | NP_001287297.1 | Gene: | dpr17 / 41470 | FlyBaseID: | FBgn0051361 | Length: | 664 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001014458.3 | Gene: | CG33543 / 3346207 | FlyBaseID: | FBgn0053543 | Length: | 468 | Species: | Drosophila melanogaster |
Alignment Length: | 201 | Identity: | 44/201 - (21%) |
---|---|---|---|
Similarity: | 70/201 - (34%) | Gaps: | 52/201 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 420 GNHAYMPCQIHRLSDKPVSWVRMRDNHIISVDETTFIADERFQSIYQEDHDYTWSLQIKYVEPSD 484
Fly 485 AGWYECQ-MATEPKLSAKVHLQIV-----KPK---TELIGDQSRFVKAGSKVALHCIVRGTLDPP 540
Fly 541 KYIIWFRGQKKISDSDERTGWYTQLDRNIFGTVGDNQNTI-----GSLIIPLVRKEDSGNYTCQP 600
Fly 601 SNSVSV 606 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr17 | NP_001287297.1 | IG_like | 414..491 | CDD:214653 | 16/70 (23%) |
Ig | 415..507 | CDD:299845 | 20/87 (23%) | ||
IG_like | 521..612 | CDD:214653 | 19/91 (21%) | ||
IGc2 | 524..605 | CDD:197706 | 18/85 (21%) | ||
CG33543 | NP_001014458.3 | IGc2 | 165..224 | CDD:197706 | 17/71 (24%) |
IG_like | 256..336 | CDD:214653 | 20/97 (21%) | ||
IGc2 | 263..327 | CDD:197706 | 18/85 (21%) | ||
FN3 | 341..445 | CDD:238020 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |