DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr17 and CG33543

DIOPT Version :9

Sequence 1:NP_001287297.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster


Alignment Length:201 Identity:44/201 - (21%)
Similarity:70/201 - (34%) Gaps:52/201 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   420 GNHAYMPCQIHRLSDKPVSWVRMRDNHIISVDETTFIADERFQSIYQEDHDYTWSLQIKYVEPSD 484
            |..|.:.|.:..:....|||: ....:|.:|:.|             :.:..:..|.|:.|..:|
  Fly   166 GRDAMVNCFVEGMPAPEVSWL-YNGEYINTVNST-------------KHNRLSNGLYIRNVSQAD 216

  Fly   485 AGWYECQ-MATEPKLSAKVHLQIV-----KPK---TELIGDQSRFVKAGSKVALHCIVRGTLDPP 540
            ||.|.|: |...|..|....:.|:     ||.   .|.:..|..:|  |..|.|.|...|  :||
  Fly   217 AGEYTCRA
MRITPTFSDSDQITILLRIQHKPHWFFNETLPVQYAYV--GGAVNLSCDAMG--EPP 277

  Fly   541 KYIIWFRGQKKISDSDERTGWYTQLDRNIFGTVGDNQNTI-----GSLIIPLVRKEDSGNYTCQP 600
            ....|....|                    |.||.|....     .:|.:.:......|:|.|:.
  Fly   278 PSFTWLHNNK--------------------GIVGFNHRIFVADYGATLQLQMKNASQFGDYKCKV 322

  Fly   601 SNSVSV 606
            :|.:.:
  Fly   323 ANPLGM 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr17NP_001287297.1 IG_like 414..491 CDD:214653 16/70 (23%)
Ig 415..507 CDD:299845 20/87 (23%)
IG_like 521..612 CDD:214653 19/91 (21%)
IGc2 524..605 CDD:197706 18/85 (21%)
CG33543NP_001014458.3 IGc2 165..224 CDD:197706 17/71 (24%)
IG_like 256..336 CDD:214653 20/97 (21%)
IGc2 263..327 CDD:197706 18/85 (21%)
FN3 341..445 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.