DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr17 and dpr4

DIOPT Version :9

Sequence 1:NP_001287297.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster


Alignment Length:206 Identity:76/206 - (36%)
Similarity:123/206 - (59%) Gaps:11/206 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   415 ITAQMGNHAYMPCQIHRLSDKPVSWVRMRDNHIISVDETTFIADERFQSIYQEDHDYTWSLQIKY 479
            :||.:|..|.:.|::..|.|:.|||:|.||.||::|...|:..|:||||::.|..| .|:|:|..
  Fly    55 VTATVGQAALLHCRVRNLGDRAVSWIRKRDLHILTVGILTYTNDQRFQSLHSEGSD-EWTLRISS 118

  Fly   480 VEPSDAGWYECQMATEPKLSAKVHLQIVKPKTELIGDQSRFVKAGSKVALHCIVRGTLDPPKYII 544
            .:|.|:|.||||::||||:|....|.:|..:.:::|:...|:|:||.:.|.|:...:..||.:|.
  Fly   119 PQPRDSGTYECQVSTEPKISQGFRLNVV
VSRAKILGNAELFIKSGSDINLTCLAMQSPVPPSFIY 183

  Fly   545 WFRGQKKISDSDERTGWYTQLDRNIFGTVGDNQNTIGSLIIPLVRKEDSGNYTCQPSNSVSVSVD 609
            |::| |::.:..:|.|         ...:.:.......|:|......|||||||.||:|.|.||.
  Fly   184 WYKG-KRVMNYSQRGG---------INVITERSTRTSKLLIAKATPADSGNYTCSPSSSDSASVV 238

  Fly   610 LHVLSGEYSAS 620
            :||::||:.|:
  Fly   239 VHVINGEHPAA 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr17NP_001287297.1 IG_like 414..491 CDD:214653 32/75 (43%)
Ig 415..507 CDD:299845 40/91 (44%)
IG_like 521..612 CDD:214653 28/90 (31%)
IGc2 524..605 CDD:197706 24/80 (30%)
dpr4NP_001014616.2 V-set 53..146 CDD:284989 40/91 (44%)
IG_like 53..145 CDD:214653 40/90 (44%)
ig 153..227 CDD:278476 22/83 (27%)
IG_like 161..>227 CDD:214653 20/75 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444707
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.