| Sequence 1: | NP_001287297.1 | Gene: | dpr17 / 41470 | FlyBaseID: | FBgn0051361 | Length: | 664 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_036019026.1 | Gene: | Negr1 / 320840 | MGIID: | 2444846 | Length: | 362 | Species: | Mus musculus |
| Alignment Length: | 316 | Identity: | 63/316 - (19%) |
|---|---|---|---|
| Similarity: | 109/316 - (34%) | Gaps: | 113/316 - (35%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 414 NITAQMGNHAYMPCQIHRLSDKPVSWVRMRDNHIISVDETTFIADERFQSIYQEDHDYTWSLQIK 478
Fly 479 YVEPSDAGWYECQMATE--PKLSAKVHLQI-VKPKT-ELIGDQSRFVKAGSKVALHCIVRG---- 535
Fly 536 -------------------------TLD------------------------------------- 538
Fly 539 -----------------PPKYIIWFRGQKKISDSDERTGWYTQLDRNIFGTVGDNQNTIGSLIIP 586
Fly 587 LVRKEDSGNYTCQPSN---SVSVSVDLHVLSGEYSASAIMSTAARTTKGG--RSTC 637 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| dpr17 | NP_001287297.1 | IG_like | 414..491 | CDD:214653 | 20/76 (26%) |
| Ig | 415..507 | CDD:299845 | 25/94 (27%) | ||
| IG_like | 521..612 | CDD:214653 | 26/176 (15%) | ||
| IGc2 | 524..605 | CDD:197706 | 24/166 (14%) | ||
| Negr1 | XP_036019026.1 | FR1 | 38..55 | CDD:409353 | 3/13 (23%) |
| Ig strand A' | 40..46 | CDD:409353 | 1/4 (25%) | ||
| IG_like | 41..129 | CDD:214653 | 26/93 (28%) | ||
| Ig strand B | 48..56 | CDD:409353 | 2/7 (29%) | ||
| CDR1 | 56..60 | CDD:409353 | 0/3 (0%) | ||
| FR2 | 61..68 | CDD:409353 | 2/9 (22%) | ||
| Ig strand C | 61..67 | CDD:409353 | 2/8 (25%) | ||
| CDR2 | 69..79 | CDD:409353 | 2/9 (22%) | ||
| Ig strand C' | 71..74 | CDD:409353 | 2/2 (100%) | ||
| Ig strand C' | 76..79 | CDD:409353 | 0/2 (0%) | ||
| FR3 | 80..115 | CDD:409353 | 13/36 (36%) | ||
| Ig strand D | 84..91 | CDD:409353 | 1/6 (17%) | ||
| Ig strand E | 94..100 | CDD:409353 | 5/7 (71%) | ||
| Ig strand F | 107..115 | CDD:409353 | 3/7 (43%) | ||
| CDR3 | 116..120 | CDD:409353 | 1/3 (33%) | ||
| Ig strand G | 120..129 | CDD:409353 | 4/9 (44%) | ||
| FR4 | 122..129 | CDD:409353 | 3/6 (50%) | ||
| Ig strand A' | 139..144 | CDD:409353 | 1/6 (17%) | ||
| IGc2 | 146..204 | CDD:197706 | 7/57 (12%) | ||
| Ig strand B | 150..157 | CDD:409353 | 3/6 (50%) | ||
| Ig strand C | 163..168 | CDD:409353 | 0/4 (0%) | ||
| Ig strand C' | 170..172 | CDD:409353 | 0/1 (0%) | ||
| Ig strand E | 180..186 | CDD:409353 | 0/5 (0%) | ||
| Ig strand F | 193..200 | CDD:409353 | 0/6 (0%) | ||
| Ig_3 | 219..295 | CDD:404760 | 16/88 (18%) | ||
| putative Ig strand A | 219..225 | CDD:409353 | 0/5 (0%) | ||
| Ig strand B | 235..239 | CDD:409353 | 0/3 (0%) | ||
| Ig strand C | 248..252 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 274..278 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 288..293 | CDD:409353 | 4/4 (100%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 1 | 1.000 | 45 | 1.000 | Domainoid score | I12107 |
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.810 | |||||