DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr17 and DIP-kappa

DIOPT Version :10

Sequence 1:NP_731670.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster


Alignment Length:208 Identity:66/208 - (31%)
Similarity:98/208 - (47%) Gaps:27/208 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   411 PVLNITAQMGNHAYMPCQIHRLSDKPVSWVRMRDNHIISVDETTFIADERFQSIYQEDHDYTWSL 475
            |:.|:|..:|..|.|.|.:..|....|:|||:....|:|:.......:.|....| .|| .:|.|
  Fly    79 PIANVTVSVGRDALMACVVENLKGYKVAWVRVDTQTILSIHHNVISQNSRISLTY-NDH-RSWYL 141

  Fly   476 QIKYVEPSDAGWYECQMATEPKLSAKVHLQIVKPK--TELIGDQSRFVKAGSKVALHCIVRGTLD 538
            .||.||.:|.|||.||:.|:|..|.|.:||:|.|.  .|.:......|:.|..::|.|..||..:
  Fly   142 HIKEVEETDRGWYMCQVNTDPMRSRKGYLQVVVPPIIVEGLTSNDMVVREGQNISLVCKARGYPE 206

  Fly   539 PPKYIIWFRGQKKISDSDERTGWYTQLDRNIFGTVGDNQNTI-GSLI-IPLVRKEDSGNYTCQPS 601
            |  |::|.|     .|.:|.          :.|  |::.|.: |.|: |..|.:.....|.|..|
  Fly   207 P--YVMWRR-----EDGEEM----------LIG--GEHVNVVDGELLHITKVSRLHMAAYLCVAS 252

  Fly   602 NSV--SVSVDLHV 612
            |.|  |:|..:|:
  Fly   253 NGVPPSISKRVHL 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr17NP_731670.1 V-set 415..507 CDD:462230 34/91 (37%)
IG_like 521..612 CDD:214653 26/94 (28%)
Ig strand B 527..531 CDD:409353 1/3 (33%)
Ig strand C 542..546 CDD:409353 1/3 (33%)
Ig strand E 581..585 CDD:409353 2/4 (50%)
Ig strand F 595..600 CDD:409353 2/4 (50%)
DIP-kappaNP_723828.1 IG_like 82..174 CDD:214653 35/93 (38%)
Ig strand B 91..95 CDD:409353 2/3 (67%)
Ig strand C 104..108 CDD:409353 1/3 (33%)
Ig strand E 139..143 CDD:409353 2/3 (67%)
Ig strand F 153..158 CDD:409353 3/4 (75%)
Ig strand G 165..168 CDD:409353 1/2 (50%)
Ig 176..267 CDD:472250 28/109 (26%)
Ig strand B 195..199 CDD:409301 1/3 (33%)
Ig strand C 208..212 CDD:409301 1/3 (33%)
Ig strand E 232..236 CDD:409301 1/3 (33%)
Ig strand F 246..251 CDD:409301 2/4 (50%)
Ig strand G 260..263 CDD:409301 1/2 (50%)
IG_like 282..368 CDD:214653
Ig strand B 288..292 CDD:409353
Ig strand C 301..305 CDD:409353
Ig strand E 330..340 CDD:409353
Ig strand F 350..355 CDD:409353
Ig strand G 363..366 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.