DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr17 and Dscaml1

DIOPT Version :9

Sequence 1:NP_001287297.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_001101611.1 Gene:Dscaml1 / 315615 RGDID:1304887 Length:2111 Species:Rattus norvegicus


Alignment Length:561 Identity:126/561 - (22%)
Similarity:191/561 - (34%) Gaps:159/561 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 FHTSPLASWLRISFVLLVLPALGFGIQVVTCSNPELGASAPDPVDLTWGGKNTEGQLTTATRSTL 152
            ||:..:  |...: |.|...|.|:.|..:..    |....|.|.|..|..:     :|..|.|.|
  Rat   290 FHSQEV--WTGHA-VELPCAASGYPIPAIRW----LKDGRPLPADSRWAKR-----ITGLTISDL 342

  Fly   153 PDSPMTT-------------QNDLITTASNL---ATAKKPATAASEAVVDTAETAETAPPTEATS 201
            ......|             .|.::|....|   .|.||..|.....|:  ...|.|..| |.|.
  Rat   343 RTEDSGTYICEVTNTFGSAEANGVLTVIDPLHVTLTPKKLKTGIGSTVI--LSCALTGSP-EFTI 404

  Fly   202 SW-SSTAVARGMSSADGAGEAIATSQSAQIGLTTQATVRQTEAQTASTATQAAAATSAATSAAIA 265
            .| .:|.:..       .||||:..     ||:.:..:..:..::.|.|.|..|...|.|:... 
  Rat   405 RWYRNTELVL-------PGEAISIR-----GLSNETLLISSAQKSHSGAYQCFATRKAQTAQDF- 456

  Fly   266 SAAAATETAAEMLISTIYPASTETDLHNSIERVEGQRGKMANAFHPGVPDSL---TKGFSIPTFL 327
             |....|.....::|:.            .|:|          .:||...||   .||..     
  Rat   457 -AIIVLEDGTPRIVSSF------------SEKV----------VNPGEQFSLMCAAKGAP----- 493

  Fly   328 PPFPVFAAADLPAYRAAADAAEAAKLAAEAAAQAAAAKTSSEAVTMSPEEQRRQMFNEQHSYLAA 392
            ||...:|..|.|..|..:....              ..|.|:..|:|            |..:..
  Rat   494 PPTVTWALDDEPVVRDGSHRTN--------------QYTMSDGTTIS------------HMNVTG 532

  Fly   393 H--RDGG-------DGAGSA---VRRNLTMP-----VLNITAQMGNHAYMPCQIHRLSDKPVSWV 440
            .  ||||       :..|||   .|.|:..|     :.||||..|....:.|::.......:.|.
  Rat   533 PQIRDGGVYRCTARNSVGSAEYQARINVRGPPSIRAMRNITAVAGRDTLINCRVIGYPYYSIKWY 597

  Fly   441 RMRDNHIISVDETTFIADERFQSIYQEDHDYTWSLQIKYVEPS-DAGWYECQMATEPKL--SAKV 502
            :          :...:.|...|.:::..     :|::..|:.. |.|.|.|.:..:|:|  |..|
  Rat   598 K----------DALLLPDNHRQVVFENG-----TLKLTDVQKGMDEGEYLCSVLIQPQLSISQSV 647

  Fly   503 HLQIVKPKTELIGDQSRFVKA--GSKVALHCIVRGTLDPPKYIIWFR-GQKKISDSDERTGWYTQ 564
            |:.:..|  .|| ....|..|  |..:.:.|:| .:.|.|..|.|.: ||..||.|         
  Rat   648 HVAVKVP--PLI-QPFEFPPASIGQLLYIPCVV-SSGDMPIRITWRKDGQVIISGS--------- 699

  Fly   565 LDRNIFGTVGDNQNTIGSLIIPLVRKEDSGNYTCQPSNSVS 605
                  |...:::..:.||.|..|..:.:|||||..||:.:
  Rat   700 ------GVTIESKEFMSSLQISSVSLKHNGNYTCIASNAAA 734

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr17NP_001287297.1 IG_like 414..491 CDD:214653 14/77 (18%)
Ig 415..507 CDD:299845 19/94 (20%)
IG_like 521..612 CDD:214653 25/88 (28%)
IGc2 524..605 CDD:197706 24/81 (30%)
Dscaml1NP_001101611.1 IG 101..173 CDD:214652
IGc2 101..168 CDD:197706
Ig 183..276 CDD:299845
IG_like 195..276 CDD:214653
I-set 291..369 CDD:254352 18/89 (20%)
IGc2 298..359 CDD:197706 15/70 (21%)
IGc2 386..447 CDD:197706 17/75 (23%)
I-set 466..560 CDD:254352 28/146 (19%)
Ig 466..556 CDD:299845 27/142 (19%)
IGc2 577..635 CDD:197706 11/72 (15%)
IG_like 665..744 CDD:214653 25/86 (29%)
Ig 673..739 CDD:143165 23/78 (29%)
I-set 748..843 CDD:254352
Ig7_DSCAM 765..843 CDD:143211
I-set 849..942 CDD:254352
Ig 861..949 CDD:299845
FN3 945..1039 CDD:238020
FN3 1046..1143 CDD:238020
fn3 1151..1237 CDD:278470
FN3 1249..1340 CDD:238020
IGc2 1364..1428 CDD:197706
FN3 1442..1532 CDD:238020
FN3 1546..1618 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.