DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr17 and Fas2

DIOPT Version :9

Sequence 1:NP_001287297.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_001284854.1 Gene:Fas2 / 31364 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster


Alignment Length:229 Identity:56/229 - (24%)
Similarity:84/229 - (36%) Gaps:42/229 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   419 MGNHAYMPCQIHRLSDKPVSWVRMRDNHIISVDETTFIADERFQSIYQEDHDYTWSLQIKYVEPS 483
            :|....:.|::....:..:.|:|..|.  |......::..             |..|.|:.|:.|
  Fly   151 LGQDYVVMCEVKADPNPTIDWLRNGDP--IRTTNDKYVVQ-------------TNGLLIRNVQES 200

  Fly   484 DAGWYECQMA---TEPKLSAKVHLQI-VKPKTELIGDQSRFVKAGSKVALHCIVRGTLDPPKYII 544
            |.|.|.|:.|   |...|...:.::: ::|:...:......|: |...|.:|..||  .|...|.
  Fly   201 DEGIYTCRAAVIETGELLERTIRVEV
FIQPEIISLPTNLEAVE-GKPFAANCTARG--KPVPEIS 262

  Fly   545 WFRGQKKISDSDERTGWYTQLDRNIFGTVGDNQNTIGSLIIPLVRKEDSGNYTCQPSNSVSVSVD 609
            |.|..             |||:.........|..| |.:.|..|.::|.|.|||...|...| ||
  Fly   263 WIRDA-------------TQLNVATADRFQVNPQT-GLVTISSVSQDDYGTYTCLAKNRAGV-VD 312

  Fly   610 ----LHVLSGEYSASAIMSTAARTTKGGRSTCHS 639
                |:||...........|.|| ||....||.:
  Fly   313 QKTKLNVLVRPQIYELYNVTGAR-TKEIAITCRA 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr17NP_001287297.1 IG_like 414..491 CDD:214653 14/71 (20%)
Ig 415..507 CDD:299845 18/91 (20%)
IG_like 521..612 CDD:214653 28/94 (30%)
IGc2 524..605 CDD:197706 23/80 (29%)
Fas2NP_001284854.1 IG_like 39..133 CDD:214653
IG_like 144..226 CDD:214653 18/89 (20%)
IGc2 152..209 CDD:197706 15/71 (21%)
I-set 230..319 CDD:254352 29/106 (27%)
IGc2 243..309 CDD:197706 23/82 (28%)
IG_like 330..424 CDD:214653 7/17 (41%)
IGc2 339..412 CDD:197706 2/7 (29%)
Ig 447..518 CDD:143165
fn3 534..611 CDD:278470
FN3 640..735 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.