DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr17 and DIP-alpha

DIOPT Version :10

Sequence 1:NP_731670.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_726871.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster


Alignment Length:204 Identity:55/204 - (26%)
Similarity:86/204 - (42%) Gaps:18/204 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   412 VLNITAQMGNHAYMPCQIHRLSDKPVSWVRMRDNHIISVDETTFIADERFQSIYQEDHDYTWSLQ 476
            :.|::..:|..|...|.:..|....|.|::.....|.::.|.....:.|....:.:.:  ||:|.
  Fly    48 ISNVSVAVGRDATFTCHVRHLGGYRVGWLKADTKAIQAIHENVITHNPRVTVSHLDQN--TWNLH 110

  Fly   477 IKYVEPSDAGWYECQMATEPKLSAKVHLQIVKPKTELIGDQSR--FVKAGSKVALHCIVRGTLDP 539
            ||.|...|.|.|.||:.|:|..|....|.:|.|...:..|.|.  .|..||.|.|.|..||..:|
  Fly   111 IKAVSEEDRGGYMCQLNTDPMKSQIGFLDVVIPPDFISEDTSSDVIVPEGSSVRLTCRARGYPEP 175

  Fly   540 PKYIIWFRGQKKISDSDERTGWYTQLDRNIFGTVGDNQNTIGSLI-IPLVRKEDSGNYTCQPSNS 603
              .:.|.|     .|.:|     ..|..|: ||.....:..|.:: :..:.:.:.|:|.|..||.
  Fly   176 --IVTWRR-----EDGNE-----IVLKDNV-GTKTLAPSFRGEVLKLSKISRNEMGSYLCIASNG 227

  Fly   604 VSVSVDLHV 612
            |..||...:
  Fly   228 VPPSVSKRI 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr17NP_731670.1 V-set 415..507 CDD:462230 24/91 (26%)
IG_like 521..612 CDD:214653 26/91 (29%)
Ig strand B 527..531 CDD:409353 2/3 (67%)
Ig strand C 542..546 CDD:409353 0/3 (0%)
Ig strand E 581..585 CDD:409353 1/4 (25%)
Ig strand F 595..600 CDD:409353 2/4 (50%)
DIP-alphaNP_726871.1 IG_like 49..129 CDD:214653 21/81 (26%)
Ig strand B 59..63 CDD:409353 1/3 (33%)
Ig strand C 72..76 CDD:409353 1/3 (33%)
Ig strand E 103..111 CDD:409353 3/9 (33%)
Ig 152..240 CDD:472250 27/98 (28%)
Ig strand B 163..167 CDD:409275 2/3 (67%)
Ig strand C 176..180 CDD:409275 0/3 (0%)
Ig strand E 205..209 CDD:409275 0/3 (0%)
Ig strand F 219..224 CDD:409275 2/4 (50%)
Ig strand G 233..236 CDD:409275 0/2 (0%)
Ig 244..337 CDD:472250
Ig strand B 261..265 CDD:409353
Ig strand C 274..278 CDD:409353
Ig strand E 305..309 CDD:409353
Ig strand F 319..324 CDD:409353
Ig strand G 332..335 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.