DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr17 and kirre

DIOPT Version :9

Sequence 1:NP_001287297.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_001245505.1 Gene:kirre / 31292 FlyBaseID:FBgn0028369 Length:956 Species:Drosophila melanogaster


Alignment Length:298 Identity:59/298 - (19%)
Similarity:120/298 - (40%) Gaps:56/298 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   354 AAEAAAQAAAAKTSSEAVTMSPEEQRRQMFNEQHSYLAAHRDGGDGAGSAVRRNLTMPVLNITAQ 418
            ::.:::.::::.:||.|.:.:.:|.:.:              |||..|    ::..|...:.||.
  Fly    48 SSSSSSSSSSSGSSSAAASSANDESKPK--------------GGDNGG----QHFAMEPQDQTAV 94

  Fly   419 MGNHAYMPCQIHRLSDK--PVSWVRMRDNHIISVDETTFIADERFQSIYQEDHDYTWSLQIKYVE 481
            :|:...:||   |:.:|  .:.|.  :|:..:. ........||: |:...|.:..:||.|..:.
  Fly    95 VGSRVTLPC---RVMEKVGALQWT--KDDFGLG-QHRNLSGFERY-SMVGSDEEGDFSLDIYPLM 152

  Fly   482 PSDAGWYECQMATEPKLSAKVHLQIVKPKTELIGDQSRFVKAGS--------KVALHCIVRGTLD 538
            ..|...|:||:...|:....:..:..| .|.|:..::..:..|.        ::.|.|:.:|. .
  Fly   153 LDDDAKYQCQVGPGPQGEQGIRSRFAK-LTVLVPPEAPKITQGDYLVTTEDREIELECVSQGG-K 215

  Fly   539 PPKYIIWFRGQKKISDSDERTGWYTQLDRNIFGTVGDNQNTIGSLIIPLVRKEDSGN--YTCQPS 601
            |...|.|..|...:         .|:....:...:.|::......|:.|..|::..|  :|||..
  Fly   216 PAAEITWIDGLGNV---------LTKGIEYVKEPLADSRRITARSILKLAPKKEHHNTTFTCQAQ 271

  Fly   602 NSV-----SVSVDLHVLSGEYSASAIMSTAARTTKGGR 634
            |:.     |..:.|.|   :|:...|:|.......||:
  Fly   272 NTADRTYRSAKLLLEV---KYAPKVIVSVVGGALAGGK 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr17NP_001287297.1 IG_like 414..491 CDD:214653 18/78 (23%)
Ig 415..507 CDD:299845 21/93 (23%)
IG_like 521..612 CDD:214653 20/105 (19%)
IGc2 524..605 CDD:197706 18/95 (19%)
kirreNP_001245505.1 Ig 87..183 CDD:299845 23/103 (22%)
IG_like 88..182 CDD:214653 22/101 (22%)
C2-set_2 189..279 CDD:285423 18/99 (18%)
Ig_2 307..379 CDD:290606 59/298 (20%)
I-set 382..462 CDD:254352
IGc2 396..446 CDD:197706
Ig 466..561 CDD:299845
IG_like 478..561 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.