DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr17 and Kirrel1

DIOPT Version :9

Sequence 1:NP_001287297.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster
Sequence 2:XP_006232737.1 Gene:Kirrel1 / 310695 RGDID:727883 Length:805 Species:Rattus norvegicus


Alignment Length:255 Identity:67/255 - (26%)
Similarity:104/255 - (40%) Gaps:39/255 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   416 TAQMGNHAYMPCQIHRLSDKPVSWVRMRDNHIISVDETTFIADERFQSIYQEDHDYTWSLQIKYV 480
            |...|:.|.:||.:...|. .|.|.  :|...:.:.: ...|..|::.:...|.. .::|:|...
  Rat    63 TVVAGHRAVLPCVLLNYSG-IVQWT--KDGLALGMGQ-GLKAWPRYRVVGSADAG-QYNLEITDA 122

  Fly   481 EPSDAGWYECQMATEPKL---SAKVHLQIVKPKTELIGDQSRFVKAGSKVALHCIVRGTLDPPKY 542
            |.||...|||| |||..|   .||:.:.|....|.:.|.....::||:...|.|..... .|...
  Rat   123 ELSDDASYECQ-ATEAALRSRRAKLTV
LIPPEDTRIDGGPVILLQAGTPYNLTCRAFNA-KPAAT 185

  Fly   543 IIWFRGQKKISDSDERTG--WYTQLDRNIFGTVGDNQNTIGSLIIPLVRKEDSGNYTCQPSN--- 602
            |||||      |..::.|  ..|:|.::     |..:.||..|:|.....:....:||:..|   
  Rat   186 IIWFR------DGTQQEGAVTSTELLKD-----GKRETTISQLLIQPTDLDIGRVFTCRSMNEAI 239

  Fly   603 ----SVSVSVDLHVLSGEYSASAIMSTAARTTKGGRS---TCHSTLGLLGILGLLWAMQG 655
                ..|:.:|:|     :..:..:|...:|...|..   ||.:|.. ..|||..||..|
  Rat   240 PNGKETSIELDVH-----HPPTVTLSIEPQTVLEGERVIFTCQATAN-PEILGYRWAKGG 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr17NP_001287297.1 IG_like 414..491 CDD:214653 19/74 (26%)
Ig 415..507 CDD:299845 27/93 (29%)
IG_like 521..612 CDD:214653 24/99 (24%)
IGc2 524..605 CDD:197706 21/89 (24%)
Kirrel1XP_006232737.1 I-set 54..148 CDD:254352 27/90 (30%)
Ig 57..148 CDD:299845 27/90 (30%)
Ig2_KIRREL3-like 170..251 CDD:143236 21/92 (23%)
I-set 255..336 CDD:254352 12/40 (30%)
Ig_2 259..337 CDD:290606 12/36 (33%)
Ig_2 340..437 CDD:290606
IG_like 346..437 CDD:214653
Ig5_KIRREL3 439..536 CDD:143306
IG_like 451..536 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.