DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr17 and ncam1a

DIOPT Version :9

Sequence 1:NP_001287297.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster
Sequence 2:XP_009293555.1 Gene:ncam1a / 30447 ZFINID:ZDB-GENE-990415-31 Length:1010 Species:Danio rerio


Alignment Length:252 Identity:63/252 - (25%)
Similarity:104/252 - (41%) Gaps:32/252 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   413 LNITAQMGNHAYMPCQIHRLSDKPVSWVRMRDNHIISVDETTFIADERFQSIYQEDHDYTWSLQI 477
            ||.||.:.....:.|......:..|.|.|         ..|...:||:: |:.::..:.|    |
Zfish   218 LNATADINQAVTLACHADGYPEPTVKWAR---------GNTELESDEKY-SLNEDGSELT----I 268

  Fly   478 KYVEPSDAGWYECQMATEP-KLSAKVHLQI-VKPKTELIGDQSRFVKAGSKVALHCIVRGTLDPP 540
            |.|...|.|.|:|....:. :.|.:|.|.: |:||...:.:|:. .:...::.|.|...|  ||.
Zfish   269 KDVNKLDEGDYKCIARNKAGERSEEVTLNVFVQPKITFLENQTA-SELEEQITLTCEATG--DPT 330

  Fly   541 KYIIWFRGQKKISDSDERTGW-----YTQLDRNIFGTVGDNQNTIGSLIIPLVRKEDSGNYTCQP 600
            ..|||..| :::...:|:..|     :..||.|:   |..:...:.||.:..|:..|:|.|.|..
Zfish   331 PNIIWSFG-RRVFTENEQASWTRPEKHKSLDGNV---VVRSDARVSSLTLKYVQFTDAGQYLCTA 391

  Fly   601 SNSVSVSVDLHVLSGEYSASAIMSTAARTTKGGRS--TCHSTLGLLGILGLLWAMQG 655
            .||:...:....|...|:.......|..|.:|..:  ||.: |...| ..:||...|
Zfish   392 RNSIGQDIQSMYLEVRYAPKIQGPQAVFTWEGNPANITCEA-LAHPG-ASVLWFRDG 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr17NP_001287297.1 IG_like 414..491 CDD:214653 18/76 (24%)
Ig 415..507 CDD:299845 21/93 (23%)
IG_like 521..612 CDD:214653 24/95 (25%)
IGc2 524..605 CDD:197706 24/85 (28%)
ncam1aXP_009293555.1 Ig 20..112 CDD:299845
I-set 21..111 CDD:254352
IG_like 121..200 CDD:214653
IGc2 128..189 CDD:197706
Ig 208..301 CDD:299845 23/96 (24%)
IG_like 219..298 CDD:214653 22/92 (24%)
Ig 300..406 CDD:299845 29/112 (26%)
IG_like 308..406 CDD:214653 26/104 (25%)
ig 413..498 CDD:278476 10/36 (28%)
IG_like 415..498 CDD:214653 10/34 (29%)
fn3 505..589 CDD:278470
FN3 624..715 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.