DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr17 and dpr7

DIOPT Version :9

Sequence 1:NP_001287297.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_001096850.2 Gene:dpr7 / 2768865 FlyBaseID:FBgn0053481 Length:312 Species:Drosophila melanogaster


Alignment Length:249 Identity:77/249 - (30%)
Similarity:120/249 - (48%) Gaps:41/249 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   407 NLTMPVL------NITAQMGNHAYMPCQIHRLSDKPVSWVRMRDNHIISVDETTFIADERFQSIY 465
            ||..|..      |::|.:...|.:.|::....::.|||:|.||.||::.:..|:..|:||..|:
  Fly    47 NLERPFFDDISPRNVSAVVDEIAILRCRVKNKGNRTVSWMRKRDLHILTTNIYTYTGDQRFSVIH 111

  Fly   466 ---QEDHDYTWSLQIKYVEPSDAGWYECQMATEPKLSAKVHLQIV------------------KP 509
               .||    |.|:|.|.:|.|:|.||||:.||||::..:.||::                  ..
  Fly   112 PPGSED----WDLKIDYAQPRDSGVYECQVNTEPKINLAICLQVIADNDFQDLKTKKRFYDTKSA 172

  Fly   510 KTELIGDQSRFVKAGSKVALHCIVRGTLDPPKYIIWFRGQKKISDSDERTGWYTQLDRNIFGTVG 574
            :.:::|.....||..|.:||.|.|  .:..|. :||:.|...:.....|.|...:.::...||..
  Fly   173 RAKILGSTEIHVKRDSTIALACSV--NIHAPS-VIWYHGSSVVDFDSLRGGISLETEKTDVGTTS 234

  Fly   575 DNQNTIGSLIIPLVRKEDSGNYTCQPSNSVSVSVDLHVLSGEYSASAIMSTAAR 628
            ....|..||       .|||||||.|:.::..||.:|||:||..|:...|:|.|
  Fly   235 RLMLTRASL-------RDSGNYTCVPNGAIPASVRVHVLTGEQPAAMQTSSAIR 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr17NP_001287297.1 IG_like 414..491 CDD:214653 28/79 (35%)
Ig 415..507 CDD:299845 35/94 (37%)
IG_like 521..612 CDD:214653 28/90 (31%)
IGc2 524..605 CDD:197706 24/80 (30%)
dpr7NP_001096850.2 V-set 56..145 CDD:284989 34/92 (37%)
IG_like 58..140 CDD:214653 30/85 (35%)
IG_like 179..265 CDD:214653 28/95 (29%)
Ig 187..257 CDD:299845 24/79 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.