DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr17 and Lsamp

DIOPT Version :9

Sequence 1:NP_001287297.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster
Sequence 2:XP_030104997.1 Gene:Lsamp / 268890 MGIID:1261760 Length:392 Species:Mus musculus


Alignment Length:379 Identity:87/379 - (22%)
Similarity:135/379 - (35%) Gaps:119/379 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   371 VTMSP------EEQRRQMFNEQHSYLAAHRDGGDGAGSAVRRNLTMPVLNITAQMGNHAYMPCQI 429
            |.:||      ||..|:...|:........|...|..            |||.:.|:.|.:.|.:
Mouse    34 VNLSPITIPGTEETMRKKAKEEEGLPVRSVDFNRGTD------------NITVRQGDTAILRCVV 86

  Fly   430 HRLSDKPVSWVRMRDNHIISVDETTFIADERFQSIYQEDHDYTWSLQIKYVEPSDAGWYECQMAT 494
            ...:.| |:|  :..:.||......:..|.|.:  .::.|...:||:|:.|:..|.|.|.|.:.|
Mouse    87 EDKNSK-VAW--LNRSGIIFAGHDKWSLDPRVE--LEKRHALEYSLRIQKVDVYDEGSYTCSVQT 146

  Fly   495 --EPKLSAKVHLQI-VKPKTELIGDQSRFVKAGSKVALHCIVRGTLDPPKYIIW---------FR 547
              |||.| :|:|.: |.||...|..... |..||.|.|.|:..|..:|  .|.|         |.
Mouse   147 QHEPKTS-QVYLIVQVPPKISNISSDVT-VNEGSNVTLVCMANGRPEP--VITWRHLTPLGREFE 207

  Fly   548 GQK----------------------KISDSDER---------------------TG--------- 560
            |::                      ::|.:|.:                     ||         
Mouse   208 GEEEYLEILGITREQSGKYECKAANEVSSADVKQVKVTVNYPPTITESKSNEATTGRQASLKCEA 272

  Fly   561 ---------WYTQLDRNIFGTVG-DNQNTIG--SLIIPLVRKEDSGNYTCQPSNSVSVSVDLHVL 613
                     ||.. |..|....| :.::|.|  ||.:..|.:|..|||||..:|.:.|:....||
Mouse   273 SAVPAPDFEWYRD-DTRINSANGLEIKSTEGQSSLTVTNVTEEHYGNYTCVAANKLGVTNASLVL 336

  Fly   614 SGEYSASAIMSTAARTTKGGRSTCH-------STLGLLGILGL---LWAMQGAM 657
                 ...::.|.....:...:|.|       |..|:.|.:.|   ||.:..::
Mouse   337 -----FKRVLPTVPHPIQEIGTTVHFKPKGPGSVRGINGSVSLAVPLWLLAASL 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr17NP_001287297.1 IG_like 414..491 CDD:214653 21/76 (28%)
Ig 415..507 CDD:299845 28/94 (30%)
IG_like 521..612 CDD:214653 34/163 (21%)
IGc2 524..605 CDD:197706 32/153 (21%)
LsampXP_030104997.1 Ig 69..159 CDD:386229 29/107 (27%)
Ig_3 163..232 CDD:372822 15/71 (21%)
Ig_3 250..325 CDD:372822 18/75 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I12107
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.